Search completed in 1.05 seconds.
3668 results for "Date":
Your results are loading. Please wait...
RTCIceCandidate.candidate - Web APIs
the read-only property candidate on the rtcicecandidate interface returns a domstring describing the candidate in detail.
... most of the other properties of rtcicecandidate are actually extracted from this string.
... this property can be configured by specifying the value of the candidate property when constructing the new candidate object using rtcicecandidate().
...And 11 more matches
Date.prototype.toLocaleDateString() - JavaScript
the tolocaledatestring() method returns a string with a language sensitive representation of the date portion of this date.
... syntax dateobj.tolocaledatestring([locales [, options]]) parameters the locales and options arguments customize the behavior of the function and let applications specify the language whose formatting conventions should be used.
... see the intl.datetimeformat() constructor for details on these parameters and how to use them.
...And 11 more matches
RTCIceCandidate.RTCIceCandidate() - Web APIs
the rtcicecandidate() constructor creates and returns a new rtcicecandidate object, which can be configured to represent a single ice candidate.
... syntax candidate = new rtcicecandidate([candidateinfo]); parameters candidateinfo optional an optional rtcicecandidateinit object providing information about the candidate; if this is provided, the candidate is initialized configured to represent the described candidate.
... return value a newly-created rtcicecandidate object, optionally configured based on the specified object based on the rtcicecandidateinit dictionary.
...And 10 more matches
RTCIceCandidateInit.candidate - Web APIs
the optional property candidate in the rtcicecandidateinit dictionary specifies the value of the rtcicecandidate object's candidate property.
... value a domstring describing the properties of the candidate, taken directly from the sdp attribute "candidate".
... the candidate string specifies the network connectivity information for the candidate.
...And 9 more matches
PaymentRequestUpdateEvent.updateWith() - Web APIs
the updatewith() method of the paymentrequestupdateevent interface updates the details of an existing paymentrequest.
... syntax paymentrequestupdateevent.updatewith(details); parameters details a paymentdetailsupdate object specifying the changes applied to the payment request: displayitems optional an array of paymentitem objects, each describing one line item for the payment request.
...when calling updatewith(), including error in the updated data causes the user agent to display the text as a general error message.
...And 5 more matches
RTCIceCandidateStats.candidateType - Web APIs
the rtcicecandidatestats interface's candidatetype property is a string which indicates the type of ice candidate the object represents.
... syntax candidatetype = rtcicecandidatestats.candidatetype; value a domstring whose value is one of the strings found in the rtcicecandidatetype enumerated type:host the candidate is a host candidate, whose ip address as specified in the rtcicecandidate.ip property is in fact the true address of the remote peer.
... srflx the candidate is a server reflexive candidate; the ip indicates an intermediary address assigned by the stun server to represent the candidate's peer anonymously.
...And 5 more matches
Date.prototype.setDate() - JavaScript
the setdate() method sets the day of the date object relative to the beginning of the currently set month.
... syntax dateobj.setdate(dayvalue) parameters dayvalue an integer representing the day of the month.
... return value the number of milliseconds between 1 january 1970 00:00:00 utc and the given date (the date object is also changed in place).
...And 5 more matches
Date.prototype.toDateString() - JavaScript
the todatestring() method returns the date portion of a date object in english in the following format separated by spaces: first three letters of the week day name first three letters of the month name two digit day of the month, padded on the left a zero if necessary four digit year (at least), padded on the left with zeros if necessary e.g.
... syntax dateobj.todatestring() return value a string representing the date portion of the given date object in human readable form in english.
... description date instances refer to a specific point in time.
...And 5 more matches
PaymentRequestUpdateEvent.PaymentRequestUpdateEvent() - Web APIs
the paymentrequestupdateevent constructor creates a new paymentrequestupdateevent object which enables a web page to update the details of a paymentrequest in response to a user action.
... actual updates are made by passing options to the updatewith() method.
... syntax var paymentrequestupdateevent = new paymentrequestupdateevent() parameters none.
...And 3 more matches
Date.prototype.setUTCDate() - JavaScript
the setutcdate() method sets the day of the month for a specified date according to universal time.
... syntax dateobj.setutcdate(dayvalue) parameters dayvalue an integer from 1 to 31, representing the day of the month.
... return value the number of milliseconds between 1 january 1970 00:00:00 utc and the updated date.
...And 3 more matches
Date.getVarDate() - Archive of obsolete content
the getvardate method returns a vt_date value from a date object.
... syntax dateobj.getvardate() parameters the required dateobj reference is a date object.
... return value returns a vt_date value.
...And 2 more matches
RTCIceCandidateStats.localCandidateId - Web APIs
the rtcicecandidatepairstats property localcandidateid is a string that uniquely identifies the local ice candidate which was analyzed to generate the rtcicecandidatestats used to compute the statistics for this pair of candidates.
... syntax localcandidateid = rtcicecandidatepairstats.localcandidateid; value a domstring giving a unique identifier for the local rtcicecandidate for the connection described by this rtcicecandidatepairstats object.
... this candidate is the source of one of the two rtcicecandidatestats objects that were used to compute the contents of this rtcicecandidatepairstats object.
...And 2 more matches
RTCIceCandidatePairStats.remoteCandidateId - Web APIs
the rtcicecandidatepairstats property remotecandidateid is a string that uniquely identifies the remote ice candidate which was analyzed to generate the rtcicecandidatestats used to compute the statistics for this pair of candidates.
... syntax remotecandidateid = rtcicecandidatepairstats.remotecandidateid; value a domstring uniquely identifies the remote ice candidate—that is, the candidate describing a configuration for the remote peer—which is represented by the remote end of these statistics.
... specifications specification status comment identifiers for webrtc's statistics apithe definition of 'rtcicecandidatepairstats.remotecandidateid' in that specification.
... candidate recommendation initial specification.
Date.prototype.getDate() - JavaScript
the getdate() method returns the day of the month for the specified date according to local time.
... syntax dateobj.getdate() return value an integer number, between 1 and 31, representing the day of the month for the given date according to local time.
... examples using getdate() the second statement below assigns the value 25 to the variable day, based on the value of the date object xmas95.
... var xmas95 = new date('december 25, 1995 23:15:30'); var day = xmas95.getdate(); console.log(day); // 25 specifications specification ecmascript (ecma-262)the definition of 'date.prototype.getdate' in that specification.
Date.prototype.getUTCDate() - JavaScript
the getutcdate() method returns the day (date) of the month in the specified date according to universal time.
... syntax dateobj.getutcdate() return value an integer number, between 1 and 31, representing the day of the month in the given date according to universal time.
... examples using getutcdate() the following example assigns the day portion of the current date to the variable day.
... var today = new date(); var day = today.getutcdate(); specifications specification ecmascript (ecma-262)the definition of 'date.prototype.getutcdate' in that specification.
MSCandidateWindowUpdate - Web APIs
mscandidatewindowupdate fires after the input method editor (ime) candidate window has been identified as needing to change size, but before any visual updates have rendered.
... syntax event property object.oncandidatewindowupdate = handler; addeventlistener method object.addeventlistener("mscandidatewindowupdate", handler, usecapture) parameters pevtobj [in] type: ihtmleventobj pointer to an ihtmleventobj interface for the current event.
... tan ime candidate window may be identified as needing to change size for any of the following reasons: as a result of displaying new / changed alternatives or predictions web applications need only register for this event once per element (the handler will remain valid for the lifetime of the element).
Date - JavaScript
javascript date objects represent a single moment in time in a platform-independent format.
... date objects contain a number that represents milliseconds since 1 january 1970 utc.
... tc39 is working on temporal, a new date/time api.
...And 69 more matches
<input type="datetime-local"> - HTML: Hypertext Markup Language
<input> elements of type datetime-local create input controls that let the user easily enter both a date and a time, including the year, month, and day as well as the time in hours and minutes.
... the control is intended to simply represent a local date and time, not necessarily the user's local date and time.
... because of the limited browser support for datetime-local, and the variations in how the inputs work, it may currently still be best to use a framework or library to present these, or to use a custom input of your own.
...And 67 more matches
<input type="date"> - HTML: Hypertext Markup Language
WebHTMLElementinputdate
<input> elements of type="date" create input fields that let the user enter a date, either with a textbox that validates the input or a special date picker interface.
...the time and datetime-local input types support time and date+time input.
... among browsers with custom interfaces for selecting dates are chrome and opera, whose data control looks like so: the edge date control looks like: and the firefox date control looks like this: value a domstring representing a date in yyyy-mm-dd format, or empty events change and input supported common attributes autocomplete, list, readonly, and step idl attributes list, value, valueasdate, valu...
...And 48 more matches
Extension Versioning, Update and Compatibility - Archive of obsolete content
if the application has a targetapplication entry but it is for an incompatible version then the application will retrieve updated compatibility information from the add-on's updateurl.
... for the maxversion it is generally permissible to use a * in place of the minor version of the application you support, for example 2.0.0.* would mean that you support any minor update to version 2 of the application.
... valid application versions automatic add-on update checking applications will periodically check for updates to installed add-ons by retrieving the updateurl.
...And 41 more matches
nsIUpdate
toolkit/mozapps/update/nsiupdateservice.idlscriptable an interface that describes an object representing an available update to the current application - this update may have several available patches from which one must be selected to download and install, for example we might select a binary difference patch first and attempt to apply that, then if the application process fails fall back to downloading a complete file-replace patch.
... this object also contains information about the update that the front end and other application services can use to learn more about what is going on.
... 1.0 66 introduced gecko 1.8 inherits from: nsisupports last changed in gecko 2.0 (firefox 4 / thunderbird 3.3 / seamonkey 2.1) method overview nsiupdatepatch getpatchat(in unsigned long index); nsidomelement serialize(in nsidomdocument updates); attributes attribute type description appversion astring the application version of this update.
...And 40 more matches
RTCIceCandidatePairStats - Web APIs
the webrtc rtcicecandidatepairstats dictionary reports statistics which provide insight into the quality and performance of an rtcpeerconnection while connected and configured as described by the specified pair of ice candidates.
... if a rtcstats-based object's type is candidate-pair, it's an rtcicecandidatepairstats object.
... properties rtcicecandidatepairstats is based upon rtcstats and inherits its properties.
...And 33 more matches
Date.parse() - JavaScript
the date.parse() method parses a string representation of a date, and returns the number of milliseconds since january 1, 1970, 00:00:00 utc or nan if the string is unrecognized or, in some cases, contains illegal date values (e.g.
... it is not recommended to use date.parse as until es5, parsing of strings was entirely implementation dependent.
... there are still many differences in how different hosts parse date strings, therefore date strings should be manually parsed (a library can help if many different formats are to be accommodated).
...And 29 more matches
RTCIceCandidate - Web APIs
the rtcicecandidate interface—part of the webrtc api—represents a candidate internet connectivity establishment (ice) configuration which may be used to establish an rtcpeerconnection.
... an ice candidate describes the protocols and routing needed for webrtc to be able to communicate with a remote device.
... when starting a webrtc peer connection, typically a number of candidates are proposed by each end of the connection, until they mutually agree upon one which describes the connection they decide will be best.
...And 24 more matches
Numbers and dates - JavaScript
« previousnext » this chapter introduces the concepts, objects and functions used to work with and perform calculations using numbers and dates in javascript.
... date object javascript does not have a date data type.
... however, you can use the date object and its methods to work with dates and times in your applications.
...And 24 more matches
datepicker - Archive of obsolete content
« xul reference home [ examples | attributes | properties | methods | related ] a datepicker allows the user to enter a date.
... normal - a datepicker with three fields for entering the year, month and date.
... grid - a datepicker with a calendar grid for selecting a date.
...And 23 more matches
nsIApplicationUpdateService
toolkit/mozapps/update/nsiupdateservice.idlscriptable this interface describes a global application service that handles performing background update checks.
... it also provides utilities for selecting and downloading update patches.
... 1.0 66 introduced gecko 1.8 inherits from: nsisupports last changed in gecko 2.0 (firefox 4 / thunderbird 3.3 / seamonkey 2.1) method overview void adddownloadlistener(in nsirequestobserver listener); astring downloadupdate(in nsiupdate update, in boolean background); void pausedownload(); void removedownloadlistener(in nsirequestobserver listener); nsiupdate selectupdate([array, size_is(updatecount)] in nsiupdate updates, in unsigned long updatecount); attributes attribute type description backgroundchecker nsiupdatechecker the update checker being used for background update checking.
...And 23 more matches
Date and time formats used in HTML - HTML: Hypertext Markup Language
certain html elements use date and/or time values.
...elements that use such formats include certain forms of the <input> element that let the user choose or specify a date, time, or both, as well as the <ins> and <del> elements, whose datetime attribute specifies the date or date and time at which the insertion or deletion of content occurred.
... for <input>, the values of type that return a value which contains a string representing a date and/or time are: date datetime datetime-local month time week examples before getting into the intricacies of how date and time strings are written and parsed in html, here are some examples that should give you a good idea what the more commonly-used date and time string formats look like.
...And 23 more matches
Setting up an update server
the goal of this document is to provide instructions for installing a locally-served firefox update.
... obtaining an update mar updates are served as mar files.
...after locating the desired version, the mars will be in the update directory.
...And 21 more matches
RTCPeerConnection.addIceCandidate() - Web APIs
when a web site or app using rtcpeerconnection receives a new ice candidate from the remote peer over its signaling channel, it delivers the newly-received candidate to the browser's ice agent by calling rtcpeerconnection.addicecandidate().
... this adds this new remote candidate to the rtcpeerconnection's remote description, which describes the state of the remote end of the connection.
... if the candidate parameter is missing or a value of null is given when calling addicecandidate(), the added ice candidate is an "end-of-candidates" indicator.
...And 20 more matches
Application Update - Archive of obsolete content
this article will hopefully explain how to update your xulrunner application using the same method that firefox, thunderbird, songbird, and chatzilla use.
... getting started you will need the following utility scripts from http://lxr.mozilla.org/mozilla/sourc...ate-packaging/ (or local source of xulrunner) common.sh make_full_update.sh you will need mar / mar.exe to build a complete update patch.
...as far as i can tell enabling the options --enable-updater and --enable-update-packaging on your configure will build you mar.
...And 19 more matches
RTCIceCandidateStats - Web APIs
the webrtc api's rtcicecandidatestats dictionary provides statistics related to an rtcicecandidate.
... properties rtcicecandidatestats is based upon the rtcstats dictionary, so it includes those properties in addition to the ones below.
... address optional a string containing the address of the candidate.
...And 19 more matches
nsIUpdatePrompt
toolkit/mozapps/update/nsiupdateservice.idlscriptable this interface describes an object that can be used to show various update-related notifications to the user.
... 1.0 66 introduced gecko 1.8 inherits from: nsisupports last changed in gecko 1.8 (firefox 1.5 / thunderbird 1.5 / seamonkey 1.0) method overview void checkforupdates(); void showupdateavailable(in nsiupdate update); void showupdatedownloaded(in nsiupdate update, [optional] in boolean background); void showupdateerror(in nsiupdate update); void showupdatehistory(in nsidomwindow parent); void showupdateinstalled(); methods checkforupdates() presents a user interface that checks for and displays the available updates.
... void checkforupdates(); parameters none.
...And 16 more matches
RTCPeerConnection: icecandidate event - Web APIs
an icecandidate event is sent to an rtcpeerconnection when an rtcicecandidate has been identified and added to the local peer by a call to rtcpeerconnection.setlocaldescription().
... the event handler should transmit the candidate to the remote peer over the signaling channel so the remote peer can add it to its set of remote candidates.
... bubbles no cancelable no interface rtcpeerconnectioniceevent event handler property rtcpeerconnection.onicecandidate description there are three reasons why the icecandidate event is fired on an rtcpeerconnection.
...And 16 more matches
Date.prototype.toLocaleString() - JavaScript
the tolocalestring() method returns a string with a language sensitive representation of this date.
... syntax dateobj.tolocalestring([locales[, options]]) parameters the locales and options arguments customize the behavior of the function and let applications specify the language whose formatting conventions should be used.
... see the intl.datetimeformat() constructor for details on these parameters and how to use them.
...And 13 more matches
Intl.DateTimeFormat - JavaScript
the intl.datetimeformat object is a constructor for objects that enable language-sensitive date and time formatting.
... constructor intl.datetimeformat() creates a new datetimeformat object.
... static methods intl.datetimeformat.supportedlocalesof() returns an array containing those of the provided locales that are supported without having to fall back to the runtime's default locale.
...And 13 more matches
RTCIceCandidate.relatedAddress - Web APIs
the rtcicecandidate interface's read-only relatedaddress property is a string indicating the related address of a relay or reflexive candidate.
... if the candidate is a host candidate (that is, its ip is in fact the real ip address of the remote peer), relatedaddress is null.
... the relatedaddress field's value is set when the rtcicecandidate() constructor is used.
...And 11 more matches
RTCIceCandidate.type - Web APIs
the rtcicecandidate interface's read-only type specifies the type of candidate the object represents.
... the type field's value is set when the rtcicecandidate() constructor is used.
... you can't specify the value of type in the options object, but the address is automatically extracted from the candidate a-line, if it's formatted properly, being taken from its cand-type field.
...And 11 more matches
RTCIceCandidate.usernameFragment - Web APIs
the read-only usernamefragment property on the rtcicecandidate interface is a string indicating the username fragment ("ufrag") that uniquely identifies a single ice interaction session.
... this value is specified when creating the rtcicecandidate by setting the corresponding usernamefragment value in the rtcicecandidateinit object when creating a new candidate with new rtcicecandidate().
... if you instead call rtcicecandidate() with a string parameter containing the candidate m-line text, the value of usernamefragment is extracted from the m-line.
...And 11 more matches
Warning: Date.prototype.toLocaleFormat is deprecated - JavaScript
the javascript warning "date.prototype.tolocaleformat is deprecated; consider using intl.datetimeformat instead" occurs when the non-standard date.prototype.tolocaleformat method is used.
... message warning: date.prototype.tolocaleformat is deprecated; consider using intl.datetimeformat instead error type warning.
... the non-standard date.prototype.tolocaleformat method is deprecated and shouldn't be used anymore.
...And 11 more matches
nsIUpdateChecker
toolkit/mozapps/update/nsiupdateservice.idlscriptable this interface describes an object that knows how to check for software updates.
... 1.0 66 introduced gecko 1.8 inherits from: nsisupports last changed in gecko 1.8 (firefox 1.5 / thunderbird 1.5 / seamonkey 1.0) method overview void checkforupdates(in nsiupdatechecklistener listener, in boolean force); void stopchecking(in unsigned short duration); constants constant value description current_check 1 constant for the stopchecking() method indicating that only the current update check should be stopped.
... current_session 2 constant for the stopchecking() method indicating that all update checks during the current session should be stopped.
...And 10 more matches
RTCIceCandidate.address - Web APIs
the rtcicecandidate interface's read-only address property is a string providing the address of the device which is the source of the candidate.
... the address field's value is set when the rtcicecandidate() constructor is used.
... you can't specify the address in the options object, but the address is automatically extracted from the candidate a-line, if it's formatted properly.
...And 10 more matches
RTCIceCandidate.protocol - Web APIs
the rtcicecandidate interface's read-only protocol property is a string which indicates whether the candidate uses udp or tcp as its transport protocol.
... protocol is null by default if not specified properly in the sdp, but this is an error condition and will result in a thrown exception when you call rtcpeerconnection.addicecandidate().
... the protocol property's value is set when the rtcicecandidate() constructor is used.
...And 10 more matches
WebGL2RenderingContext.invalidateSubFramebuffer() - Web APIs
the webgl2renderingcontext.invalidatesubframebuffer() method of the webgl 2 api invalidates portions of the contents of attachments in a framebuffer.
... syntax void gl.invalidatesubframebuffer(target, attachments, x, y, width, height); parameters target a glenum specifying the binding point (target).
... attachments an array of glenum specifying the attachment points to invalidate.
...And 10 more matches
Intl.DateTimeFormat.prototype.formatToParts() - JavaScript
the intl.datetimeformat.prototype.formattoparts() method allows locale-aware formatting of strings produced by datetimeformat formatters.
... syntax datetimeformat.formattoparts(date) parameters date optional the date to format.
... return value an array of objects containing the formatted date in parts.
...And 10 more matches
RTCIceCandidate.priority - Web APIs
the rtcicecandidate interface's read-only priority property specifies the candidate's priority according to the remote peer; the higher this value is, the better the remote peer considers the candidate to be.
... as is the case with most of rtcicecandidate's properties, the value of priority is extracted from the candidate a-line string specified when creating the rtcicecandidate.
... the a-line string is obtained either from the rtcicecandidateinit property candidate or from an a-line string passed into rtcpeerconnection.addicecandidate() instead of an rtcicecandidate.
...And 9 more matches
RTCIceCandidate.relatedPort - Web APIs
the rtcicecandidate interface's read-only relatedport property indicates the port number of reflexive or relay candidates.
... if the candidate is a host candidate (that is, its ip is in fact the real ip address of the remote peer), relatedport is null.
... the relatedport field's value is set when the rtcicecandidate() constructor is used.
...And 9 more matches
RTCIceCandidateStats.deleted - Web APIs
the rtcicecandidatestats dictionary's deleted property indicates whether or not the candidate has been deleted or released.
... syntax isdeleted = rtcicecandidatestats.deleted; value a boolean value indicating whether or not the candidate has been deleted or released.
... if this value is true, the candidate described by the rtcicecandidatestats object is no longer under consideration.
...And 9 more matches
RTCIceTransport.getSelectedCandidatePair() - Web APIs
the rtcicetransport method getselectedcandidatepair() returns an rtcicecandidatepair object containing the current best-choice pair of ice candidates describing the configuration of the endpoints of the transport.
... syntax candidatepair = rtcicetransport.getselectedcandidatepair(); parameters none.
... return value a rtcicecandidatepair object describing the configurations of the currently-selected candidate pair's two endpoints.
...And 9 more matches
Date.prototype.toLocaleTimeString() - JavaScript
the tolocaletimestring() method returns a string with a language sensitive representation of the time portion of this date.
... syntax dateobj.tolocaletimestring([locales[, options]]) parameters the locales and options arguments customize the behavior of the function and let applications specify the language whose formatting conventions should be used.
... see the intl.datetimeformat() constructor for details on these parameters and how to use them.
...And 9 more matches
Date.prototype.toString() - JavaScript
the tostring() method returns a string representing the specified date object.
... syntax dateobj.tostring() return value a string representing the given date.
... description date instances inherit their tostring() method from date.prototype, not object.prototype.
...And 9 more matches
Date.prototype.toLocaleFormat() - Archive of obsolete content
the non-standard tolocaleformat() method converts a date to a string using the specified formatting.
... intl.datetimeformat is an alternative to format dates in a standards-compliant way.
... see also the newer version of date.prototype.tolocaledatestring().
...And 8 more matches
AddonUpdateChecker
the addonupdatechecker is used to download and parse update information for an add-on's update manifest.
... if all you care about is finding the newest version for an addon then you probably want to use findupdates() instead.
... to import the addonupdatechecker, use: components.utils.import("resource://gre/modules/addonupdatechecker.jsm"); method overview updateinfo getcompatibilityupdate(in updateinfo updates[], in string version, in boolean ignorecompatibility, in string appversion, in string platformversion) updateinfo getnewestcompatibleupdate(in updateinfo updates[], in string appversion, in string platformversion) void checkforupdates(in string id, in string type, in string updatekey, string url, in updatechecklistener listener) constants constant description error_timeout the update check timed out.
...And 8 more matches
nsIUpdateCheckListener
toolkit/mozapps/update/nsiupdateservice.idlscriptable an interface describing an object that listens to the progress of an update check operation.
... 1.0 66 introduced gecko 1.8 inherits from: nsisupports last changed in gecko 1.8 (firefox 1.5 / thunderbird 1.5 / seamonkey 1.0) method overview void oncheckcomplete(in nsixmlhttprequest request, [array, size_is(updatecount)] in nsiupdate updates, in unsigned long updatecount); void onerror(in nsixmlhttprequest request, in nsiupdate update); void onprogress(in nsixmlhttprequest request, in unsigned long position, in unsigned long totalsize); methods oncheckcomplete() called when the update check is completed.
... void oncheckcomplete( in nsixmlhttprequest request, [array, size_is(updatecount)] in nsiupdate updates, in unsigned long updatecount ); parameters request the nsixmlhttprequest object handling the update check.
...And 8 more matches
RTCIceCandidate.port - Web APIs
the rtcicecandidate interface's read-only port property contains the port number on the device at the address given by ip at which the candidate's peer can be reached.
... as is the case with most of rtcicecandidate's properties, the value of port is extracted from the candidate a-line string specified when creating the rtcicecandidate.
... the a-line string is obtained either from the rtcicecandidateinit property candidate or from a-line string passed into the constructor upon using new rtcicecandidate().
...And 8 more matches
RTCIceCandidateType - Web APIs
the webrtc api's rtcicecandidatetype enumerated type provides a set of domstring values representing the types of ice candidate that can arrive.
... these strings are taken directly from the candidate a-line in sdp.
... values these candidate types are listed in order of priority; the higher in the list they are, the more efficient they are.
...And 8 more matches
Date() constructor - JavaScript
creates a javascript date instance that represents a single moment in time in a platform-independent format.
... date objects contain a number that represents milliseconds since 1 january 1970 utc.
... syntax new date() new date(value) new date(datestring) new date(year, monthindex [, day [, hours [, minutes [, seconds [, milliseconds]]]]]) note: the only correct way to instantiate a new date object is by using the new operator.
...And 8 more matches
UpdateListener
an updatelistener receives messages from an update check for a single add-on, though it is possible to pass the same updatelistener to as many calls to findupdates() as you like.
... for each individual update check, the following methods will be called on the listener: either oncompatibilityupdateavailable() or onnocompatibilityupdateavailable(), depending on whether compatibility information for the requested application version was seen.
... either onupdateavailable() or onnoupdateavailable(), depending on whether a newer version of the addon was found.
...And 7 more matches
nsIUpdateItem
method overview void init(in astring id, in astring version, in astring installlocationkey, in astring minappversion, in astring maxappversion, in astring name, in astring downloadurl, in astring xpihash, in astring iconurl, in astring updateurl, in astring updatekey, in long type, in astring targetappid); attributes attribute type description iconurl astring the url of the icon that can be shown for this item.
... objectsource astring returns a js object source representing an nsiupdateitem.
... updatekey astring the public key to verify updates for this item.
...And 7 more matches
nsIUpdateManager
toolkit/mozapps/update/nsiupdateservice.idlscriptable this interface describes a global application service that maintains a list of previously installed updates, as well as the currently in use update.
... 1.0 66 introduced gecko 1.8 inherits from: nsisupports last changed in gecko 1.8 (firefox 1.5 / thunderbird 1.5 / seamonkey 1.0) method overview nsiupdate getupdateat(in long index); void saveupdates(); attributes attribute type description activeupdate nsiupdate an nsiupdate object describing the currently in use update.
... this update is not in the history list.
...And 7 more matches
IDBCursor.update() - Web APIs
WebAPIIDBCursorupdate
the update() method of the idbcursor interface returns an idbrequest object, and, in a separate thread, updates the value at the current position of the cursor in the object store.
... be aware that you can't call update() (or idbcursor.delete()) on cursors obtained from idbindex.openkeycursor().
... syntax var anidbrequest = myidbcursor.update(value); parameters value the new value to be stored at the current position.
...And 7 more matches
Intl.DateTimeFormat.prototype.format() - JavaScript
the intl.datetimeformat.prototype.format() method formats a date according to the locale and formatting options of this intl.datetimeformat object.
... syntax datetimeformat.format(date) parameters date the date to format.
... description the format getter formats a date into a string according to the locale and formatting options of this intl.datetimeformat object.
...And 7 more matches
ISO8601DateUtils.jsm
the iso8601dateutils.jsm javascript code module provides methods that make it easy to convert javascript date objects into iso 8601 format date strings and back.
... to use this, you first need to import the code module into your javascript scope: components.utils.import("resource://gre/modules/iso8601dateutils.jsm"); once you've imported the module, you can then use the iso8601dateutils object it exports.
... using the iso 8601 date utilities to convert a date string into a date object, simply use: dateobj = iso8601dateutils.parse(datestring); to convert a date object into a date string: datestring = iso8601dateutils.create(dateobj); method overview string create(adate); date parse(adatestring); methods create creates an iso 8601 format date string, e.g.
...And 6 more matches
PaymentDetailsUpdate - Web APIs
the paymentdetailsupdate dictionary is used to provide updated information to the payment user interface after it has been instantiated.
... this can be done either by calling the paymentrequestupdateevent.updatewith() method or by using the paymentrequest.show() method's detailspromise parameter to provide a promise that returns a paymentdetailsupdate that updates the payment information before the user interface is even enabled for the first time.
... properties the paymentdetailsupdate dictionary is based on the paymentdetailsbase dictionary, and inherits its properties, which are included in the list below.
...And 6 more matches
RTCIceCandidateInit - Web APIs
the webrtc api's rtcicecandidateinit dictionary, which contains the information needed to fundamentally describe an rtcicecandidate.
... rtcicecandidateinit is used when using new rtcicecandidate() to create a new ice candidate object.
... it's also used as the return value from the rtcicecandidate.tojson() method, and can be passed directly into rtcpeerconnection.addicecandidate() to add a candidate to the peer connection.
...And 6 more matches
RTCIceCandidatePairStats.state - Web APIs
the state property in an rtcicecandidatepairstats object indicates the state of the check list of which the candidate pair is a member.
... syntax state = rtcicecandidatepairstats.state; value a domstring whose value is one of those found in the rtcstatsicecandidatepairstate enumerated type.
... ice check lists during ice negotiation, the ice layer builds up a check list, which is a list of potential pairings of ice candidates.
...And 6 more matches
RTCIceTransport.getLocalCandidates() - Web APIs
the rtcicetransport method getlocalcandidates() returns an array of rtcicecandidate objects, one for each of the candidates that have been gathered by the local device during the current ice agent session.
... the local candidates are placed in this list by the ice agent prior to being delivered to the local client's code in an icecandidate event so that the client can forward the candidates to the remote peer.
... syntax localcandidates = rtcicetransport.getlocalcandidates(); parameters none.
...And 6 more matches
RTCIceTransport.getRemoteCandidates() - Web APIs
the rtcicetransport method getremotecandidates() returns an array which contains one rtcicecandidate for each of the candidates that have been received from the remote peer so far during the current ice gathering session.
... each time your signaling code calls rtcpeerconnection.addicecandidate() to add a received candidate to the ice session, the ice agent places it in the list returned by this function.
... syntax remotecandidates = rtcicetransport.getremotecandidates(); parameters none.
...And 6 more matches
RTCPeerConnection.onicecandidate - Web APIs
the rtcpeerconnection property onicecandidate property is an eventhandler which specifies a function to be called when the icecandidate event occurs on an rtcpeerconnection instance.
...this lets the ice agent perform negotiation with the remote peer without the browser itself needing to know any specifics about the technology being used for signaling; simply implement this method to use whatever messaging technology you choose to send the ice candidate to the remote peer.
... syntax rtcpeerconnection.onicecandidate = eventhandler; value this should be set to a function which you provide that accepts as input an rtcpeerconnectioniceevent object representing the icecandidate event.
...And 6 more matches
WebGL2RenderingContext.invalidateFramebuffer() - Web APIs
the webgl2renderingcontext.invalidateframebuffer() method of the webgl 2 api invalidates the contents of attachments in a framebuffer.
... syntax void gl.invalidateframebuffer(target, attachments); parameters target a glenum specifying the binding point (target).
... attachments an array of glenum specifying the attachment points to invalidate.
...And 6 more matches
Date.UTC() - JavaScript
the date.utc() method accepts parameters similar to the date constructor, but treats them as utc.
... syntax since ecmascript 2017: date.utc(year[, month[, day[, hour[, minute[, second[, millisecond]]]]]]) ecmascript 2016 and earlier: (month used to be required) date.utc(year, month[, day[, hour[, minute[, second[, millisecond]]]]]) parameters year a full year.
... return value a number representing the number of milliseconds for the given date since january 1, 1970, 00:00:00, utc.
...And 6 more matches
Date.prototype.getTime() - JavaScript
you can use this method to help assign a date and time to another date object.
... syntax dateobj.gettime() return value a number representing the milliseconds elapsed between 1 january 1970 00:00:00 utc and the given date.
... reduced time precision to offer protection against timing attacks and fingerprinting, the precision of new date().gettime() might get rounded depending on browser settings.
...And 6 more matches
Date.prototype.setHours() - JavaScript
the sethours() method sets the hours for a specified date according to local time, and returns the number of milliseconds since january 1, 1970 00:00:00 utc until the time represented by the updated date instance.
... syntax dateobj.sethours(hoursvalue[, minutesvalue[, secondsvalue[, msvalue]]]) versions prior to javascript 1.3 dateobj.sethours(hoursvalue) parameters hoursvalue ideally, an integer between 0 and 23, representing the hour.
... if a value greater than 23 is provided, the datetime will be incremented by the extra hours.
...And 6 more matches
RTCIceCandidate.component - Web APIs
the read-only component property on the rtcicecandidate interface is a string which indicates whether the candidate is an rtp or an rtcp candidate.
... if a candidate represents both rtp and rtcp multiplexed together, it is reported as an rtp candidate.
... syntax var component = rtcicecandidate.component; value a domstring which is "rtp" for rtp (or rtp and rtcp multiplexed together) candidates or "rtcp" for rtcp candidates.
...And 5 more matches
RTCIceCandidate.sdpMid - Web APIs
the read-only property sdpmid on the rtcicecandidate interface returns a domstring specifying the media stream identification tag of the media component with which the candidate is associated.
... this id uniquely identifies a given stream for the component with which the candidate is associated.
... this property can be configured by specifying the value of the sdpmid property when constructing the new candidate object using rtcicecandidate().
...And 5 more matches
RTCIceCandidate.tcpType - Web APIs
the rtcicecandidate interface's read-only tcptype property is included on tcp candidates to provide additional details about the candidate type.
... the tcptype field's value is set when the rtcicecandidate() constructor is used.
... you can't directly set its value; instead, its value is automatically extracted from the candidate a-line, if it's formatted properly.
...And 5 more matches
RTCIceCandidatePairStats.selected - Web APIs
the non-standard, firefox-specific rtcicecandidatepairstats property selected indicates whether or not the candidate pair described by the object is the one currently being used to communicate with the remote peer.
... syntax isselected = icpstats.selected; value a firefox-specific boolean value which is true if the candidate pair described by this object is the one currently in use.
... in any other browser, you can determine the selected candidate pair by looking for a stats object of type transport, which is an rtctransportstats object.
...And 5 more matches
RTCIceCandidateStats.priority - Web APIs
the rtcicecandidatestats dictionary's priority property is a positive integer value indicating the priority (or desirability) of the described candidate.
... during ice negotiation while setting up a webrtc peer connection, the priority values reported to the remote peer by a user agent are used to determine which candidates are considered "more desirable".
... the higher the value, the more desirable the candidate is.
...And 5 more matches
RTCPeerConnection.canTrickleIceCandidates - Web APIs
the read-only rtcpeerconnection property cantrickleicecandidates returns a boolean which indicates whether or not the remote peer can accept trickled ice candidates.
... ice trickling is the process of continuing to send candidates after the initial offer or answer has already been sent to the other peer.
...that way, the offer contains all of the candidates.
...And 5 more matches
RTCPeerConnection: icecandidateerror event - Web APIs
the webrtc api event icecandidateerror is sent to an rtcpeerconnection if an error occurs while performing ice negotiations through a stun or turn server.
... bubbles no cancelable no interface rtcpeerconnectioniceerrorevent event handler property rtcpeerconnection.onicecandidateerror description the error object's errorcode property is one of the numeric stun error codes.
...error 701 indicates that none of the ice candidates were able to successfully make contact with the stun or turn server.
...And 5 more matches
Date.prototype.setFullYear() - JavaScript
the setfullyear() method sets the full year for a specified date according to local time.
... syntax dateobj.setfullyear(yearvalue[, monthvalue[, datevalue]]) parameters yearvalue an integer specifying the numeric value of the year, for example, 1995.
... datevalue optional.
...And 5 more matches
Intl.DateTimeFormat() constructor - JavaScript
the intl.datetimeformat() constructor for objects that enable language-sensitive date and time formatting.
... syntax new intl.datetimeformat([locales[, options]]) parameters locales optional a string with a bcp 47 language tag, or an array of such strings.
... options optional an object with some or all of the following properties: datestyle the date formatting style to use when calling format().
...And 5 more matches
modDateChanged - Archive of obsolete content
summary returns whether file has been modified since a certain date.
... method of file object syntax boolean moddatechanged (filespecobject asourcefolder, number anolddate); parameters the moddatechanged method has the following parameters: asourcefolder a filespecobject representing the file to be queried.
... anolddate a double representing the date.
...And 4 more matches
nsIUpdatePatch
toolkit/mozapps/update/nsiupdateservice.idlscriptable an interface that describes an object representing a patch file that can be downloaded and applied to a version of this application so that it can be updated.
... 1.0 66 introduced gecko 1.8 inherits from: nsisupports last changed in gecko 2.0 (firefox 4 / thunderbird 3.3 / seamonkey 2.1) method overview nsidomelement serialize(in nsidomdocument updates); attributes attribute type description finalurl astring the final url this patch was being downloaded from.
... selected boolean true if this patch is currently selected as the patch to be downloaded and installed for this update transaction.
...And 4 more matches
HTMLMediaElement: timeupdate event - Web APIs
the timeupdate event is fired when the time indicated by the currenttime attribute has been updated.
...user agents are encouraged to vary the frequency of the event based on the system load and the average cost of processing the event each time, so that the ui updates are not any more frequent than the user agent can comfortably handle while decoding the video.
... bubbles no cancelable no interface event target element default action none event handler property globaleventhandlers.ontimeupdate specification html5 media examples these examples add an event listener for the htmlmediaelement's timeupdate event, then post a message when that event handler has reacted to the event firing.
...And 4 more matches
RTCIceCandidate.foundation - Web APIs
the rtcicecandidate interface's read-only foundation property is a string which uniquely identifies the candidate across multiple transports.
... as such, the foundation can be used to correlate candidates that are present on multiple rtcicetransport objects syntax var foundation = rtcicecandidate.foundation; value a domstring which uniquely identifies the candidate across all rtcicetransports on which it is available.
... note: if port is null — and port is supported by the user agent — passing the candidate to addicecandidate() will fail, throwing an operationerror exception.
...And 4 more matches
RTCIceCandidate.sdpMLineIndex - Web APIs
the read-only sdpmlineindex property on the rtcicecandidate interface is a zero-based index of the m-line describing the media associated with the candidate.
... this value is specified when creating the rtcicecandidate by setting the corresponding sdpmlineindex value in the rtcicecandidateinit object when creating a new candidate with new rtcicecandidate().
... if you instead call rtcicecandidate() with a string parameter containing the candidate m-line text, the value of sdpmlineindex is extracted from the m-line.
...And 4 more matches
RTCIceCandidatePair.local - Web APIs
the local property of the rtcicecandidatepair dictionary specifies the rtcicecandidate which describes the configuration of the local end of a viable webrtc connection.
... syntax localcandidate = rtcicecandidatepair.local; value an rtcicecandidate which describes the configuration of the local end of a viable pair of ice candidates.
... the rtcicecandidatepair is returned by the rtcicetransport method getselectedcandidatepair().
...And 4 more matches
RTCIceCandidatePair.remote - Web APIs
the remote property of the rtcicecandidatepair dictionary specifies the rtcicecandidate describing the configuration of the remote end of a viable webrtc connection.
... syntax remotecandidate = rtcicecandidatepair.remote; value an rtcicecandidate which describes the configuration of the remote end of a viable pair of ice candidates.
... the rtcicecandidatepair is returned by the rtcicetransport method getselectedcandidatepair().
...And 4 more matches
RTCIceCandidatePair - Web APIs
the rtcicecandidatepair dictionary describes a pair of ice candidates which together comprise a description of a viable connection between two webrtc endpoints.
... it is used as the return value from rtcicetransport.getselectedcandidatepair() to identify the currently-selected candidate pair identified by the ice agent.
... properties local an rtcicecandidate describing the configuration of the local end of the connection.
...And 4 more matches
RTCIceCandidatePairStats.availableOutgoingBitrate - Web APIs
the rtcicecandidatepairstats property availableoutgoingbitrate returns a value indicative of the available outbound capacity of the network connection represented by the candidate pair.
... syntax availableoutgoingbitrate = rtcicecandidatepairstats.availableoutgoingbitrate; value a floating-point value which approximates the amount of available bandwidth for outgoing data on the network connection described by the rtcicecandidatepair.
... the rtcicecandidatepair described by this object has never been used.
...And 4 more matches
RTCIceCandidateStats.url - Web APIs
the rtcicecandidatestats dictionary's url property specifies the url of the ice server from which the described candidate was obtained.
... this property is only available for local candidates.
... syntax url = rtcicecandidatestats.url; value a domstring specifying the url of the ice server from which the candidate described by the rtcicecandidatestats was obtained.
...And 4 more matches
RTCIceTransport.onselectedcandidatepairchange - Web APIs
the rtcicetransport interface's onselectedcandidatepairchange event handler specifies a function to be called to handle the selectedcandidatepairchange event, which is fired when the ice agent selects a new candidate pair to be used for the connection.
... syntax rtcicetransport.onselectedcandidatepairchange = candidatepairhandler; value this propoerty should be set to reference an event handler function to be called by the ice agent when it discovers a new candidate pair that the rtcicetransport will be using for communication with the remote peer.
... this event will occur at least once, and may occur more than once if the ice agent continues to identify candidate pairs that will work better, more closely match the requested parameters, and so forth.
...And 4 more matches
RTCIceTransport: selectedcandidatepairchange event - Web APIs
a selectedcandidatepairchange event is sent to an rtcicetransport when the ice agent selects a new pair of candidates that describe the endpoints of a viable connection.
... the pair of candidates is in turn described by an rtcicecandidatepair object which contains one rtcicecandidate representing the local end of the connection, and another representing the remote end of the connection.
... together, the candidates can be used to establish a connection to be used by the rtcicetransport, and, by extension, by an rtcpeerconnection.
...And 4 more matches
Date.prototype.setMonth() - JavaScript
the setmonth() method sets the month for a specified date according to the currently set year.
... syntax dateobj.setmonth(monthvalue[, dayvalue]) versions prior to javascript 1.3 dateobj.setmonth(monthvalue) parameters monthvalue a zero-based integer representing the month of the year offset from the start of the year.
... return value the number of milliseconds between 1 january 1970 00:00:00 utc and the updated date.
...And 4 more matches
Date.prototype.toTimeString() - JavaScript
the totimestring() method returns the time portion of a date object in human readable form in american english.
... syntax dateobj.totimestring() return value a string representing the time portion of the given date in human readable form in american english.
... description date instances refer to a specific point in time.
...And 4 more matches
WebAssembly.validate() - JavaScript
the webassembly.validate() function validates a given typed array of webassembly binary code, returning whether the bytes form a valid wasm module (true) or not (false).
... syntax webassembly.validate(buffersource); parameters buffersource a typed array or arraybuffer containing webassembly binary code to be validated.
... examples using validate the following example (see the validate.html source code, and see it live too) fetches a .wasm module and converts it into a typed array.
...And 4 more matches
NPN_InvalidateRect - Archive of obsolete content
« gecko plugin api reference « browser side plug-in api summary invalidates the specified portion of the plugin's drawing area, adding it to the region that needs to be redrawn when the plugin next repaints its contents.
... syntax #include <npapi.h> void npn_invalidaterect(npp instance, nprect *invalidrect); parameters the function has the following parameters: instance pointer to the plug-in instance to invalidate a portion of.
... invalidrect the area to invalidate, specified in a coordinate system that originates at the top left of the plug-in's content area.
...And 3 more matches
NPN_InvalidateRegion - Archive of obsolete content
« gecko plugin api reference « browser side plug-in api summary invalidates the specified drawing region prior to repainting or refreshing a windowless plug-in.
... syntax #include <npapi.h> void npn_invalidateregion(npp instance, npregion invalidregion); parameters the function has the following parameters: instance pointer to the current plug-in instance.
... invalidregion the area to invalidate, specified in a coordinate system that originates at the top left of the plug-in.
...And 3 more matches
UpdateInfo
updateinfo objects hold information about available versions of add-ons and are generated as a result of an update check performed by addonupdatechecker.
... attributes attribute type description version string the version of the update.
... updateurl string the updateurl that the update can be downloaded from.
...And 3 more matches
Animation.updatePlaybackRate() - Web APIs
the updateplaybackrate() method of the web animations api's animation interface sets the speed of an animation after first synchronizing its playback position.
... updateplaybackrate() is an asynchronous method that sets the speed of an animation after synchronizing with its current playback position, ensuring that the resulting change in speed does not produce a sharp jump.
... after calling updateplaybackrate() the animation's playbackrate is not immediately updated.
...And 3 more matches
File.lastModifiedDate - Web APIs
the file.lastmodifieddate read-only property returns the last modified date of the file.
... files without a known last modified date returns the current date .
... syntax var time = instanceoffile.lastmodifieddate value a date object indicating the date and time at which the file was last modified.
...And 3 more matches
MSCandidateWindowShow - Web APIs
mscandidatewindowshow fires immediately after the input method editor (ime) candidate window is set to appear, but before it renders.
... syntax event property object.oncandidatewindowshow = handler; addeventlistener method object.addeventlistener("mscandidatewindowshow", handler, usecapture) parameters pevtobj [in] type: ihtmleventobj pointer to an ihtmleventobj interface for the current event.
... this event fires after the positioning information of the ime candidate window has been determined.
...And 3 more matches
RTCIceCandidatePairStats.nominated - Web APIs
the rtcicecandidatepairstats property nominated specifies whether or not the candidate pair described by the underlying rtcicecandidatepair has been nominated to be used as the configuration for the webrtc connection.
... syntax nominated = rtcicecandidatepairstats.nominated; value a boolean value which is set to true by the ice layer if the controlling user agent has indicated that the candidate pair should be used to configure the webrtc connection between the two peers.
... note: if more than one candidate pair are nominated at the same time, the one whose priority is higher will be selected for use.
...And 3 more matches
RTCIceCandidatePairStats.priority - Web APIs
the obsolete rtcicecandidatepairstats property priority reports the priority of the candidate pair as an integer value.
... the higher the value, the more likely the webrtc layer is to select the candidate pair when the time comes to establish (or re-establish) a connection between the two peers.
... syntax pairpriority = rtcicecandidatepairstats.priority; value an integer value indicating the priority of this pair of candidates as compared to other pairs on the same peer connection.
...And 3 more matches
RTCIceCandidateStats.networkType - Web APIs
the rtcicecandidatestats dictionary's networktype property specifies the type of network used by a local candidate to communicate with a remote peer.
... note: the networktype property is only included in rtcicecandidatestats objects for local candidates (that is, candidates generated locally and included in an sdp offer or answer that has been sent to the remote peer).
... syntax networktype = rtcicecandidatestats.networktype; value a domstring whose value is taken from the rtcnetworktype enumerated type.
...And 3 more matches
RTCIceCandidateStats.protocol - Web APIs
the rtcicecandidatestats dictionary's protocol property specifies the protocol the specified candidate would use for communication with the remote peer.
... syntax protocol = rtcicecandidatestats.protocol; value the value is one of the members of the rtciceprotocol enumerated string type: tcp the candidate, if selected, would use tcp as the transport protocol for its data.
... the tcptype property provides additional information about the kind of tcp candidate represented by the object.
...And 3 more matches
RTCIceCandidateStats.relayProtocol - Web APIs
the rtcicecandidatestats dictionary's relayprotocol property specifies the protocol being used by a local ice candidate to communicate with the turn server.
... the ice protocl being used by the candidate otherwise can be obtained from the protocol property.
... syntax relayprotocol = rtcicecandidatestats.relayprotocol; value a domstring identifying the protocol being used by the endpoint to communicate with the turn server.
...And 3 more matches
RTCPeerConnection.onicecandidateerror - Web APIs
the rtcpeerconnection.onicecandidateerror property is an eventhandler which specifies a function which is called to handle the icecandidateerror event when it occurs on an rtcpeerconnection instance.
... this event is fired when an error occurs during the ice candidate gathering process.
... syntax rtcpeerconnection.onicecandidateerror = eventhandler; value this should be set to a function you provide which is passed a single parameter: an rtcpeerconnectioniceerrorevent object describing the icecandidateerror event.
...And 3 more matches
RTCStatsIceCandidatePairState - Web APIs
the rtcstatsicecandidatepairstate enumerated type represents the set of string values which are possible for the rtcicecandidatepairstats object's state property.
... this represents the state of this candidate pair within the ice check list for the rtcpeerconnection.
... see ice check lists in rtcicecandidatepairstats.state for further information about how ice check lsits work.
...And 3 more matches
RangeError: invalid date - JavaScript
the javascript exception "invalid date" occurs when a string leading to an invalid date has been provided to date or date.parse().
... message rangeerror: invalid date (edge) rangeerror: invalid date (firefox) rangeerror: invalid time value (chrome) rangeerror: provided date is not in valid range (chrome) error type rangeerror what went wrong?
... a string leading to an invalid date has been provided to date or date.parse().
...And 3 more matches
Date.prototype.getDay() - JavaScript
the getday() method returns the day of the week for the specified date according to local time, where 0 represents sunday.
... for the day of the month, see date.prototype.getdate().
... syntax dateobj.getday() return value an integer number, between 0 and 6, corresponding to the day of the week for the given date, according to local time: 0 for sunday, 1 for monday, 2 for tuesday, and so on.
...And 3 more matches
Date.prototype.getYear() - JavaScript
the getyear() method returns the year in the specified date according to local time.
... syntax dateobj.getyear() return value a number representing the year of the given date, according to local time, minus 1900.
... var xmas = new date('december 25, 1995 23:15:00'); var year = xmas.getyear(); // returns 95 years above 1999 the second statement assigns the value 100 to the variable year.
...And 3 more matches
Date.now() - JavaScript
the static date.now() method returns the number of milliseconds elapsed since january 1, 1970 00:00:00 utc.
... syntax var timeinms = date.now(); return value a number representing the milliseconds elapsed since the unix epoch.
...engines which have not been updated to support this method can work around the absence of this method using the following shim: if (!date.now) { date.now = function now() { return new date().gettime(); }; } examples reduced time precision to offer protection against timing attacks and fingerprinting, the precision of date.now() might get rounded depending on browser settings.
...And 3 more matches
Date.prototype.setSeconds() - JavaScript
the setseconds() method sets the seconds for a specified date according to local time.
... syntax dateobj.setseconds(secondsvalue[, msvalue]) versions prior to javascript 1.3 dateobj.setseconds(secondsvalue) parameters secondsvalue an integer between 0 and 59, representing the seconds.
... return value the number of milliseconds between 1 january 1970 00:00:00 utc and the updated date.
...And 3 more matches
Date.prototype.setUTCFullYear() - JavaScript
the setutcfullyear() method sets the full year for a specified date according to universal time.
... syntax dateobj.setutcfullyear(yearvalue[, monthvalue[, dayvalue]]) parameters yearvalue an integer specifying the numeric value of the year, for example, 1995.
... return value the number of milliseconds between 1 january 1970 00:00:00 utc and the updated date.
...And 3 more matches
Date.prototype.setUTCMilliseconds() - JavaScript
the setutcmilliseconds() method sets the milliseconds for a specified date according to universal time.
... syntax dateobj.setutcmilliseconds(millisecondsvalue) parameters millisecondsvalue a number between 0 and 999, representing the milliseconds.
... return value the number of milliseconds between 1 january 1970 00:00:00 utc and the updated date.
...And 3 more matches
Date.prototype.setUTCMonth() - JavaScript
the setutcmonth() method sets the month for a specified date according to universal time.
... syntax dateobj.setutcmonth(monthvalue[, dayvalue]) parameters monthvalue an integer between 0 and 11, representing the months january through december.
... return value the number of milliseconds between 1 january 1970 00:00:00 utc and the updated date.
...And 3 more matches
Date.prototype.setUTCSeconds() - JavaScript
the setutcseconds() method sets the seconds for a specified date according to universal time.
... syntax dateobj.setutcseconds(secondsvalue[, msvalue]) parameters secondsvalue an integer between 0 and 59, representing the seconds.
... return value the number of milliseconds between 1 january 1970 00:00:00 utc and the updated date.
...And 3 more matches
Date.prototype.setYear() - JavaScript
the setyear() method sets the year for a specified date according to local time.
... syntax dateobj.setyear(yearvalue) parameters yearvalue an integer.
... return value the number of milliseconds between 1 january 1970 00:00:00 utc and the updated date.
...And 3 more matches
Date.prototype.toGMTString() - JavaScript
the togmtstring() method converts a date to a string, using internet greenwich mean time (gmt) conventions.
... the exact format of the value returned by togmtstring() varies according to the platform and browser, in general it should represent a human readable date string.
... syntax dateobj.togmtstring() return value a string representing the given date following the internet greenwich mean time (gmt) convention.
...And 3 more matches
Date.prototype.toJSON() - JavaScript
the tojson() method returns a string representation of the date object.
... syntax dateobj.tojson() return value a string representation of the given date.
... description date instances refer to a specific point in time.
...And 3 more matches
Intl.DateTimeFormat.supportedLocalesOf() - JavaScript
the intl.datetimeformat.supportedlocalesof() method returns an array containing those of the provided locales that are supported in date and time formatting without having to fall back to the runtime's default locale.
... syntax intl.datetimeformat.supportedlocalesof(locales[, options]) parameters locales a string with a bcp 47 language tag, or an array of such strings.
... return value an array of strings representing a subset of the given locale tags that are supported in date and time formatting without having to fall back to the runtime's default locale.
...And 3 more matches
Debugging update problems
checking update requests if you're debugging the application update feature in firefox or other mozilla applications, you may need to see what requests are occurring.
... you can do this using the live http headers addon to determine the url of the update request.
... that url might look something like: https://aus3.mozilla.org/update/3/firefox/12.0a1/20120106040225/darwin_x86_64-gcc3-u-i386-x86_64-shark/nightly-profiling/darwin%2010.8.0/default/default/update.xml?force=1 you can then request this url manually to see what's inside.
...And 2 more matches
FC_DecryptUpdate
name fc_decryptupdate - decrypt a block of a multi-part encryption operation.
... syntax ck_rv fc_decryptupdate( ck_session_handle hsession, ck_byte_ptr pencryptedpart, ck_ulong usencryptedpartlen, ck_byte_ptr ppart, ck_ulong_ptr puspartlen ); parameters hsession [in] session handle.
... description fc_decryptupdate decrypts a block of data according to the attributes of the previous call to fc_decryptinit.
...And 2 more matches
FC_DigestUpdate
name fc_digestupdate - process the next block of a multi-part digest operation.
... syntax ck_rv fc_digestupdate( ck_session_handle hsession, ck_byte_ptr ppart, ck_ulong uspartlen ); parameters hsession [in] session handle.
... description fc_digestupdate starts or continues a multi-part digest operation.
...And 2 more matches
FC_EncryptUpdate
name fc_encryptupdate - encrypt a block of a multi-part encryption operation.
... syntax ck_rv fc_encryptupdate( ck_session_handle hsession, ck_byte_ptr ppart, ck_ulong uspartlen, ck_byte_ptr pencryptedpart, ck_ulong_ptr pusencryptedpartlen ); parameters hsession [in] session handle.
... description fc_encryptupdate encrypts a block of data according to the attributes of the previous call to fc_encryptinit.
...And 2 more matches
FC_SignUpdate
name fc_signupdate - process the next block of a multi-part signing operation.
... syntax ck_rv fc_signupdate( ck_session_handle hsession, ck_byte_ptr ppart, ck_ulong uspartlen ); parameters hsession [in] session handle.
... description fc_signupdate starts or continues a multi-part signature operation.
...And 2 more matches
FC_VerifyUpdate
name fc_verifyupdate - process the next block of a multi-part verify operation.
... syntax ck_rv fc_verifyupdate( ck_session_handle hsession, ck_byte_ptr ppart, ck_ulong uspartlen ); parameters hsession [in] session handle.
... description fc_verifyupdate starts or continues a multi-part signature verification operation where the signature is an appendix to the data.
...And 2 more matches
JS_ObjectIsDate
this article covers features introduced in spidermonkey 1.8.5 determines if a specified object is a date object.
... syntax bool js_objectisdate(jscontext *cx, js::handleobject obj); name type description cx jscontext * pointer to a javascript context from which to derive runtime information.
... description js_objectisdate() can be used to check if you are dealing with a date object, or a date object used across compartments (or windows or sites, in the browser embedding).
...And 2 more matches
nsIUpdateTimerManager
toolkit/mozapps/update/nsiupdatetimermanager.idlscriptable this interface provides a global application service that provides support for long-duration timers (on the order of many days, weeks, or even months).
... these timers are used to schedule update checks in the future, for example.
... 1.0 66 introduced gecko 1.8 inherits from: nsisupports last changed in gecko 1.8 (firefox 1.5 / thunderbird 1.5 / seamonkey 1.0) method overview void registertimer(in astring id, in nsitimercallback callback, in unsigned long interval); methods registertimer() presents a user interface that checks for and displays the available updates.
...And 2 more matches
PaymentDetailsUpdate.error - Web APIs
the paymentdetailsupdate dictionary's error property is a human-readable domstring which provides an error message to be displayed if the specified information doesn't offer any valid shipping options.
... syntax errorstring = paymentdetailsupdate.error; paymentdetailsupdate.error = errorstring; value a domstring specifying the string to display to the user if the information specified in the paymentdetailsupdate doesn't provide any valid shipping options.
... the paymentdetailsupdate object specifies no valid shipping options in its shippingoptions list.
...And 2 more matches
PaymentRequestUpdateEvent - Web APIs
the paymentrequestupdateevent interface is used for events sent to a paymentrequest instance when changes are made to shipping-related information for a pending paymentrequest.
... constructor paymentrequestupdateevent() secure context creates a new paymentrequestupdateevent object.
... methods in addition to methods inherited from the parent interface, event, paymentrequestupdateevent offers the following methods: paymentrequestupdateevent.updatewith() secure context if the event handler determines that information included in the payment request needs to be changed, or that new information needs to be added, it calls updatewith() with the information that needs to be replaced or added.
...And 2 more matches
RTCIceCandidate. toJSON() - Web APIs
the rtcicecandidate method tojson() converts the rtcicecandidate on which it's called into json in the form of an rtcicecandidateinit object.
... syntax json = rtcicecandidate.tojson(); return value an object conforming to the rtcicecandidateinit dictionary, whose members' values are set to the corresponding values in the rtcicecandidate object.
... example this simple example obtains a json string representing an rtcicecandidate found in the variable candidate.
...And 2 more matches
RTCIceCandidateInit.sdpMLineIndex - Web APIs
the optional property sdpmlineindex in the rtcicecandidateinit dictionary specifies the value of the rtcicecandidate object's sdpmlineindex property.
... value a number containing a 0-based index into the set of m-lines providing media descriptions, indicating which media source is associated with the candidate, or null if no such association is available.
... note: attempting to add a candidate (using addicecandidate()) that has a value of null for either sdpmid or sdpmlineindex will throw a typeerror exception.
...And 2 more matches
RTCIceCandidateInit.sdpMid - Web APIs
the optional property sdpmid in the rtcicecandidateinit dictionary specifies the value of the rtcicecandidate object's sdpmid property.
... value a domstring which uniquely identifies the source media component from which the candidate draws data, or null if no such association exists for the candidate.
... note: attempting to add a candidate (using addicecandidate()) that has a value of null for either sdpmid or sdpmlineindex will throw a typeerror exception.
...And 2 more matches
RTCIceCandidatePairStats.availableIncomingBitrate - Web APIs
the rtcicecandidatepairstats property availableincomingbitrate returns a value indicative of the available inbound capacity of the network connection represented by the candidate pair.
... syntax availableincomingbitrate = rtcicecandidatepairstats.availableincomingbitrate; value a floating-point value which approximates the amount of available bandwidth for incoming data on the network connection described by the rtcicecandidatepair.
... the value returned is calculated by adding up the available bit rate for every rtp stream using the connection described by this candidate pair.
...And 2 more matches
RTCIceCandidatePairStats.consentExpiredTimestamp - Web APIs
the rtcicecandidatepairstats property consentexpiredtimestamp indicates the time at which the most recent stun binding response expired.
... syntax consentexpiration = rtcicecandidatepairstats.consentexpiredtimestamp; value a domhighrestimestamp object that indicates the time at which the stun binding that allows the two peers described by this rtcicecandidatepair to communicate will expire (or the time at which the binding did expire, if the time has passed).
... this property's value is undefined if there have been no stun binding responses yet on the candidate pair.
...And 2 more matches
RTCIceCandidatePairStats.packetsReceived - Web APIs
the rtcicecandidatepairstats dictionary's packetsreceived property indicates the total number of packets of any kind that have been received on the connection described by the pair of candidates.
... the number of packets sent to date on the connection can be obtained using packetssent.
... syntax packetsreceived = rtcicecandidatepairstats.packetsreceived; value an integer value indicating the total number of packets, of any kind, which have been received on the connection described by the two candidates comprising this pair.
...And 2 more matches
RTCIceCandidatePairStats.packetsSent - Web APIs
the rtcicecandidatepairstats dictionary's packetssent property indicates the total number of packets which have been sent on the connection described by the pair of candidates.
... the number of packets received to date on the connection can be obtained using packetsreceived.
... syntax packetssent = rtcicecandidatepairstats.packetssent; value an integer value indicating the total number of packets, of any kind, which have been sent on the connection described by the two candidates comprising this pair.
...And 2 more matches
RTCIceCandidateStats.transportId - Web APIs
the rtcicecandidatestats dictionary's transportid property is a string that uniquely identifies the transport that produced the rtctransportstats from which information about this candidate was taken.
... syntax transportid = rtcicecandidatestats.transportid; value a domstring whose value uniquely identifies the transport from which any transport-related information accumulated in the rtcicecandidatestats was taken.
... this can be used to compare candidates that would use the same transport, for example.
...And 2 more matches
WebGLRenderingContext.validateProgram() - Web APIs
the webglrenderingcontext.validateprogram() method of the webgl api validates a webglprogram.
... syntax void gl.validateprogram(program); parameters program a webglprogram to validate.
... examples var program = gl.createprogram(); // attach pre-existing shaders gl.attachshader(program, vertexshader); gl.attachshader(program, fragmentshader); gl.linkprogram(program); gl.validateprogram(program); if ( !gl.getprogramparameter( program, gl.link_status) ) { var info = gl.getprograminfolog(program); throw 'could not compile webgl program.
...And 2 more matches
XRSession.updateRenderState() - Web APIs
the updaterenderstate() method of the xrsession interface of webxr api schedules changes to be applied to the active render state prior to rendering of the next frame.
... syntax xrsession.updaterenderstate(newstate) parameters newstate an object conforming to the xrrenderstateinit dictionary specifying the properties of the session's renderstate to update before rendering the next frame.
... the baselayer specified in newstate was created by an xrsession other than the one on which updaterenderstate() was called.
...And 2 more matches
update - CSS: Cascading Style Sheets
the update css media feature can be used to test how frequently (if at all) the output device is able to modify the appearance of content.
... syntax the update feature is specified as a single keyword value chosen from the list below.
... none once it has been rendered, the layout can no longer be updated.
...And 2 more matches
Date.prototype[@@toPrimitive] - JavaScript
the [@@toprimitive]() method converts a date object to a primitive value.
... syntax date()[symbol.toprimitive](hint); return value the primitive value of the given date object.
... description the [@@toprimitive]() method of the date object returns a primitive value, that is either of type number or of type string.
...And 2 more matches
Date.prototype.getMonth() - JavaScript
the getmonth() method returns the month in the specified date according to local time, as a zero-based value (where zero indicates the first month of the year).
... syntax dateobj.getmonth() return value an integer number, between 0 and 11, representing the month in the given date according to local time.
... examples using getmonth() the second statement below assigns the value 11 to the variable month, based on the value of the date object xmas95.
...And 2 more matches
Date.prototype.setMilliseconds() - JavaScript
the setmilliseconds() method sets the milliseconds for a specified date according to local time.
... syntax dateobj.setmilliseconds(millisecondsvalue) parameters millisecondsvalue a number between 0 and 999, representing the milliseconds.
... return value the number of milliseconds between 1 january 1970 00:00:00 utc and the updated date.
...And 2 more matches
Date.prototype.setMinutes() - JavaScript
the setminutes() method sets the minutes for a specified date according to local time.
... syntax dateobj.setminutes(minutesvalue[, secondsvalue[, msvalue]]) versions prior to javascript 1.3 dateobj.setminutes(minutesvalue) parameters minutesvalue an integer between 0 and 59, representing the minutes.
... return value the number of milliseconds between 1 january 1970 00:00:00 utc and the updated date.
...And 2 more matches
Date.prototype.setTime() - JavaScript
the settime() method sets the date object to the time represented by a number of milliseconds since january 1, 1970, 00:00:00 utc.
... syntax dateobj.settime(timevalue) parameters timevalue an integer representing the number of milliseconds since 1 january 1970, 00:00:00 utc.
... return value the number of milliseconds between 1 january 1970 00:00:00 utc and the updated date (effectively, the value of the argument).
...And 2 more matches
Date.prototype.setUTCHours() - JavaScript
the setutchours() method sets the hour for a specified date according to universal time, and returns the number of milliseconds since january 1, 1970 00:00:00 utc until the time represented by the updated date instance.
... syntax dateobj.setutchours(hoursvalue[, minutesvalue[, secondsvalue[, msvalue]]]) parameters hoursvalue an integer between 0 and 23, representing the hour.
... return value the number of milliseconds between january 1, 1970 00:00:00 utc and the updated date.
...And 2 more matches
Date.prototype.setUTCMinutes() - JavaScript
the setutcminutes() method sets the minutes for a specified date according to universal time.
... syntax dateobj.setutcminutes(minutesvalue[, secondsvalue[, msvalue]]) parameters minutesvalue an integer between 0 and 59, representing the minutes.
... return value the number of milliseconds between 1 january 1970 00:00:00 utc and the updated date.
...And 2 more matches
Date.prototype.valueOf() - JavaScript
the valueof() method returns the primitive value of a date object.
... syntax dateobj.valueof() return value the number of milliseconds between 1 january 1970 00:00:00 utc and the given date.
... description the valueof() method returns the primitive value of a date object as a number data type, the number of milliseconds since midnight 01 january, 1970 utc.
...And 2 more matches
modDate - Archive of obsolete content
summary returns the last modified date of a specified file or directory.
... method of file object syntax double moddate ( filespecobject nativefolderpath ); parameters the moddate method has the following parameters: nativefolderpath a filespecobject representing the queried file.
... returns a double number representing the date that the file was last modified.
... example f = getfolder("program"); filesource = getfolder(f, "myfile.txt"); err = file.moddate(filesource); see moddatechanged for an example of comparing the dates of two files.
UpdateCheckListener
updatechecklisteners are passed the results of update checks performed by the addonupdatechecker.
... method overview void onupdatecheckcomplete(in updateinfo results[]) void onupdatecheckerror(in integer status) methods onupdatecheckcomplete() called when the update check completed successfully.
... void onupdatecheckcomplete( in updateinfo results[] ) parameters results an array of updateinfo objects representing the available add-on versions onupdatecheckerror() called when the update check fails.
... void onupdatecheckerror( in integer status ) parameters status a value representing the type of failure; see the range of possible values.
FC_DecryptDigestUpdate
name fc_decryptdigestupdate - continue a multi-part decrypt and digest operation syntax ck_rv fc_decryptdigestupdate( ck_session_handle hsession, ck_byte_ptr pencryptedpart, ck_ulong ulencryptedpartlen, ck_byte_ptr ppart, ck_ulong_ptr pulpartlen ); parameters hsession [in] session handle.
... description fc_decryptdigestupdate continues a multi-part decrypt and digest operation.
...a user must log into the token (to assume the nss user role) before calling fc_decryptdigestupdate.
... return value examples see also nsc_decryptdigestupdate ...
FC_DecryptVerifyUpdate
name fc_decryptverifyupdate - continue a multi-part decrypt and verify operation syntax ck_rv fc_decryptverifyupdate( ck_session_handle hsession, ck_byte_ptr pencrypteddata, ck_ulong ulencrypteddatalen, ck_byte_ptr pdata, ck_ulong_ptr puldatalen ); parameters hsession [in] session handle.
... description fc_decryptverifyupdate continues a multi-part decryption and and signature verification operation.
...a user must log into the token (to assume the nss user role) before calling fc_decryptverifyupdate.
... return value examples see also nsc_decryptverifyupdate ...
FC_DigestEncryptUpdate
name fc_digestencryptupdate - continue a multi-part digest and encryption operation syntax ck_rv fc_digestencryptupdate( ck_session_handle hsession, ck_byte_ptr ppart, ck_ulong ulpartlen, ck_byte_ptr pencryptedpart, ck_ulong_ptr pulencryptedpartlen ); parameters hsession [in] session handle.
... description fc_digestencryptupdate continues a multi-part digest and encryption operation.
...a user must log into the token (to assume the nss user role) before calling fc_digestencryptupdate.
... return value examples see also nsc_digestencryptupdate ...
FC_SignEncryptUpdate
name fc_signencryptupdate - continue a multi-part signing and encryption operation syntax ck_rv fc_signencryptupdate( ck_session_handle hsession, ck_byte_ptr ppart, ck_ulong ulpartlen, ck_byte_ptr pencryptedpart, ck_ulong_ptr pulencryptedpartlen ); parameters hsession [in] session handle.
... description fc_signencryptupdate continues a multi-part signature and encryption operation.
...a user must log into the token (to assume the nss user role) before calling fc_signencryptupdate.
... return value examples see also nsc_signencryptupdate ...
JS_ClearDateCaches
this article covers features introduced in spidermonkey 17 clear the cache of calculated local time from each date object.
... syntax void js_cleardatecaches(jscontext *cx); name type description cx jscontext * pointer to a javascript context from which to derive runtime information.
... description js_cleardatecaches clears the cache of calculated local time from each date object.
... see also mxr id search for js_cleardatecaches js_newdateobject js_newdateobjectmsec js_objectisdate bug 285615 replaced by js::resettimezone ...
JS_NewDateObject
this article covers features introduced in spidermonkey 1.8.5 creates a new date object instance for the given time and date.
... syntax jsobject * js_newdateobject(jscontext *cx, int year, int mon, int mday, int hour, int min, int sec); name type description cx jscontext * the context in which to create the new date object.
... description creates and returns a new jsobject representing a javascript date object, which is pre-configured using the specified values.
... see also mxr id search for js_newdateobject js_newdateobjectmsec js_objectisdate bug 625870 ...
JS_NewDateObjectMsec
this article covers features introduced in spidermonkey 1.8.5 creates a new date object instance, configured to represent the date and time indicated by the specified time in milliseconds since the unix epoch.
... syntax jsobject * js_newdateobjectmsec(jscontext *cx, double msec); name type description cx jscontext * the context.
... description the returned jsobject is a standard javascript date.
... see also mxr id search for js_newdateobjectmsec js_newdateobject js_objectisdate bug 625870 ...
nsIMsgDBViewCommandUpdater
the nsimsgdbviewcommandupdater interface controls changes that occur as the selection changes.
... last changed in gecko 1.9 (firefox 3) inherits from: nsisupports in thunderbird this is implemented for different windows in several different places: nsmsgdbviewcommandupdater (for the standalone message window) nsmsgdbviewcommandupdater (for the threadpane message window) nsmsgsearchcommandupdater (for search dialogs) method overview void updatecommandstatus(); void displaymessagechanged(in nsimsgfolder afolder, in astring asubject, in acstring akeywords); void updatenextmessageafterdelete(); methods updatecommandstatus() called when the number of selected items changes.
... void updatecommandstatus(); parameters none.
... updatenextmessageafterdelete() allows the backend to tell the front end to re-determine which message we should select after a delete or move void updatenextmessageafterdelete(); parameters none.
HTMLTimeElement.dateTime - Web APIs
the htmltimeelement.datetime property is a domstring that reflects the datetime html attribute, containing a machine-readable form of the element's date and time value.
... the format of the string must follow one of the following html microsyntaxes: microsyntax description examples valid month string yyyy-mm 2011-11, 2013-05 valid date string yyyy-mm-dd 1887-12-01 valid yearless date string mm-dd 11-12 valid time string hh:mm hh:mm:ss hh:mm:ss.mmm 23:59 12:15:47 12:15:52.998 valid local date and time string yyyy-mm-dd hh:mm yyyy-mm-dd hh:mm:ss yyyy-mm-dd hh:mm:ss.mmm yyyy-mm-ddthh:mm yyyy-mm-ddthh:mm:ss yyyy-mm-ddthh:mm:ss.mmm 2013-12-25 11:12 1972-07-25 13:43:07 1941-03-15 07:06:23.678 2013-12-25t11:12 1972-07-25t13:43:07 1941-03-15t07:06:23.678 valid time-zone offset string z +hhmm +hh:mm ...
... -hhmm -hh:mm z +0200 +04:30 -0300 -08:00 valid global date and time string any combination of a valid local date and time string followed by a valid time-zone offset string 2013-12-25 11:12+0200 1972-07-25 13:43:07+04:30 1941-03-15 07:06:23.678z 2013-12-25t11:12-08:00 valid week string yyyy-www 2013-w46 four or more ascii digits yyyy 2013, 0001 valid duration string pddthhmmss pddthhmms.xs pddthhmms.xxs pddthhmms.xxxs pthhmmss pthhmms.xs pthhmms.xxs pthhmms.xxxs ww dd hh mm ss p12dt7h12m13s p12dt7h12m13.3s p12dt7h12m13.45s p12dt7h12m13.455s pt7h12m13s pt7h12m13.2s pt7h12m13.56s pt7h12m13.999s 7d 5h 24m 13s syntax datetimestrin...
...g = timeelt.datetime; timeelt.datetime = datetimestring example // assumes there is <time id="t"> element in the html var t = document.getelementbyid("t"); t.datetime = "6w 5h 34m 5s"; specifications specification status comment html living standardthe definition of 'htmltimeelement' in that specification.
PaymentDetailsUpdate.shippingAddressErrors - Web APIs
the paymentdetailsupdate dictionary's shippingaddresserrors property, if present, contains an addresserrors object whose contents provide error messages for one or more of the values in the paymentaddress specified as paymentrequest.shippingaddress.
... syntax var addresserrors = paymentdetailsupdate.shippingaddresserrors; value an addresserrors object, which contains domstrings describing errors in the properties of a paymentaddress.
... specifications specification status comment payment request apithe definition of 'paymentdetailsupdate.shippingaddresserrors' in that specification.
... candidate recommendation initial definition.
RTCIceCandidatePairStats.bytesReceived - Web APIs
the rtcicecandidatepairstats property bytesreceived indicates the total number of payload bytes—that is, bytes which aren't overhead such as headers or padding—that hve been received to date on the connection described by the candidate pair.
... syntax received = rtcicecandidatepairstats.bytesreceived; value an integer value indicating the total number of bytes received so far on the connection described by this candidate pair.
... specifications specification status comment identifiers for webrtc's statistics apithe definition of 'rtcicecandidatepairstats.bytesreceived' in that specification.
... candidate recommendation initial specification.
RTCIceCandidatePairStats.bytesSent - Web APIs
the rtcicecandidatepairstats property bytessent indicates the total number of payload bytes—that is, bytes which aren't overhead such as headers or padding—that hve been sent so far on the connection described by the candidate pair.
... syntax sent = rtcicecandidatepairstats.bytessent; value an integer value indicating the total number of bytes sent so far on the connection described by this candidate pair.
... specifications specification status comment identifiers for webrtc's statistics apithe definition of 'rtcicecandidatepairstats.bytessent' in that specification.
... candidate recommendation initial specification.
RTCIceCandidatePairStats.circuitBreakerTriggerCount - Web APIs
the rtcicecandidatepairstats property circuitbreakertriggercount indicates the number of times the circuit-breaker has been triggered to indicate a connection timeout or other unexpected connection abort on this specific connection configuration.
... syntax cbtcount = rtcicecandidatepairstats.circuitbreakertriggercount; value an integer value indicating the number of times the circuit-breaker has been triggered for the 5-tuple used by this connection.
... specifications specification status comment identifiers for webrtc's statistics apithe definition of 'rtcicecandidatepairstats.circuitbreakertriggercount' in that specification.
... candidate recommendation initial specification.
RTCIceCandidatePairStats.consentRequestsSent - Web APIs
the rtcicecandidatepairstats property consentrequestssent specifies the number of consent requests that have been sent by this peer to the remote peer on the connection described by the pair of candidates.
... syntax consentrequestssent = rtcicecandidatepairstats.consentrequestssent; value an integer indicating the number of consent requests this peer has sent to the other peer over the connection described by the pair of candidates referenced by this rtcicecandidatepairstats object.
... specifications specification status comment identifiers for webrtc's statistics apithe definition of 'rtcicecandidatepairstats.consentrequestssent' in that specification.
... candidate recommendation initial specification.
RTCIceCandidatePairStats.currentRoundTripTime - Web APIs
the rtcicecandidatepairstats property currentroundtriptime is a floating-point value indicating the number of seconds it takes for data to be sent by this peer to the remote peer and back over the connection described by this pair of ice candidates.
... syntax rtt = rtcicecandidatepairstats.currentroundtriptime; value a floating-point value indicating the round-trip time, in seconds for the connection described by the pair of candidates for which this rtcicecandidatepairstats object offers statistics.
... specifications specification status comment identifiers for webrtc's statistics apithe definition of 'rtcicecandidatepairstats.currentroundtriptime' in that specification.
... candidate recommendation initial specification.
RTCIceCandidatePairStats.firstRequestTimestamp - Web APIs
the rtcicecandidatepairstats property firstrequesttimestamp specifies the time at which the first stun request was sent on the described candidate pair.
... syntax firstrequesttimestamp = rtcicecandidatepairstats.firstrequesttimestamp; value a domhighrestimestamp object indicating the timestamp at which the first stun request was sent on the connection described by the described pair of candidates.
... you can use this value in combination with lastrequesttimestamp and requestssent to compute the average interval between consecutive connectivity checks: avgcheckinterval = (candidatepairstats.lastrequesttimestamp - candidatepairstats.firstrequesttimestamp) / candidatepairstats.requestssent; specifications specification status comment identifiers for webrtc's statistics apithe definition of 'rtcicecandidatepairstats.firstrequesttimestamp' in that specification.
... candidate recommendation initial specification.
RTCIceCandidatePairStats.lastPacketReceivedTimestamp - Web APIs
the rtcicecandidatepairstats property lastpacketreceivedtimestamp indicates the time at which the connection described by the candidate pair last received a packet.
... syntax lastpacketreceivedtimestamp = rtcicecandidatepairstats.lastpacketreceivedtimestamp; value a domhighrestimestamp object indicating the timestamp at which the connection described by pair of candidates last received a packet, stun packets excluded.
... specifications specification status comment identifiers for webrtc's statistics apithe definition of 'rtcicecandidatepairstats.lastpacketreceivedtimestamp' in that specification.
... candidate recommendation initial specification.
RTCIceCandidateStats.lastPacketSentTimestamp - Web APIs
the rtcicecandidatepairstats property lastpacketsenttimestamp indicates the time at which the connection described by the candidate pair last sent a packet, not including stun packets.
... syntax lastpacketsenttimestamp = rtcicecandidatepairstats.lastpacketsenttimestamp; value a domhighrestimestamp object indicating the timestamp at which the connection described by pair of candidates last sent a packet, stun packets excluded.
... specifications specification status comment identifiers for webrtc's statistics apithe definition of 'rtcicecandidatepairstats.lastpacketsenttimestamp' in that specification.
... candidate recommendation initial specification.
RTCIceCandidatePairStats.lastRequestTimestamp - Web APIs
the rtcicecandidatepairstats property lastrequesttimestamp indicates the time at which the most recent stun request was sent on the described candidate pair.
... syntax lastrequesttimestamp = rtcicecandidatepairstats.lastrequesttimestamp; value a domhighrestimestamp object indicating the timestamp at which the last (most recent) stun request was sent on the connection indicated by the described pair of candidates.
... you can use this value in combination with firstrequesttimestamp and requestssent to compute the average interval between consecutive connectivity checks: avgcheckinterval = (candidatepairstats.lastrequesttimestamp - candidatepairstats.firstrequesttimestamp) / candidatepairstats.requestssent; specifications specification status comment identifiers for webrtc's statistics apithe definition of 'rtcicecandidatepairstats.lastrequesttimestamp' in that specification.
... candidate recommendation initial specification.
RTCIceCandidateStats.lastResponseTimestamp - Web APIs
the rtcicecandidatepairstats property lastresponsetimestamp indicates the time at which the last stun response was received on the described candidate pair.
... syntax lastresponsetimestamp = rtcicecandidatepairstats.lastresponsetimestamp; value a domhighrestimestamp object indicating the timestamp at which the most recent stun response was received on the connection defined by the described pair of candidates.
... specifications specification status comment identifiers for webrtc's statistics apithe definition of 'rtcicecandidatepairstats.lastresponsetimestamp' in that specification.
... candidate recommendation initial specification.
RTCIceCandidatePairStats.requestsReceived - Web APIs
the rtcicecandidatepairstats dictionary's requestsreceived property indicates the total number of stun connectivity check requests that have been received so far on the connection described by this pairing of candidates.
... syntax requestsreceived = rtcicecandidatepairstats.requestsreceived; value an integer value which specifies the number of stun connectivity and/or consent requests that have been received to date on the connection described by this pair of ice candidates.
... specifications specification status comment identifiers for webrtc's statistics apithe definition of 'rtcicecandidatepairstats.requestsreceived' in that specification.
... candidate recommendation initial specification.
RTCIceCandidatePairStats.requestsSent - Web APIs
the rtcicecandidatepairstats dictionary's requestssent property indicates the total number of stun connectivity check requests that have been sent so far on the connection described by this pair of candidates.
... syntax requestssent = rtcicecandidatepairstats.requestssent; value an integer value which specifies the number of stun connectivity requests that have been sent to date on the connection described by this pair of ice candidates.
... specifications specification status comment identifiers for webrtc's statistics apithe definition of 'rtcicecandidatepairstats.requestssent' in that specification.
... candidate recommendation initial specification.
RTCIceCandidatePairStats.responsesReceived - Web APIs
the responsesreceived property in the rtcicecandidatepairstats dictionary indicates the total number of stun connectivity check responses that have been received on the connection described by this pair of candidates.
... syntax responsesreceived = rtcicecandidatepairstats.responsesreceived; value an integer value which specifies the number of stun connectivity request responses that have been received on the connection described by this pair of candidates so far.
... specifications specification status comment identifiers for webrtc's statistics apithe definition of 'rtcicecandidatepairstats.responsesreceived' in that specification.
... candidate recommendation initial specification.
RTCIceCandidatePairStats.responsesSent - Web APIs
the rtcicecandidatepairstats dictionary's responsessent property indicates the total number of stun connectivity check responses that have been sent so far on the connection described by this pair of candidates.
... syntax responsessent = rtcicecandidatepairstats.responsessent; value an integer value indicating the number of times a repsonse has been sent to a stun connectivity check request.
... specifications specification status comment identifiers for webrtc's statistics apithe definition of 'rtcicecandidatepairstats.responsessent' in that specification.
... candidate recommendation initial specification.
RTCIceCandidatePairStats.retransmissionsReceived - Web APIs
the rtcicecandidatepairstats dictionary's retransmissionsreceived property indicates the total number of stun connectivity check request retransmissions that have been received so far on the pair of candidates.
... syntax retransmissionsreceived = rtcicecandidatepairstats.retransmissionsreceived; value an integer value indicating the total number of retransmitted stun connectivity check requests have been received on the connection referenced by this candidate pair so far.
... specifications specification status comment identifiers for webrtc's statistics apithe definition of 'rtcicecandidatepairstats.retransmissionsreceived' in that specification.
... candidate recommendation initial specification.
RTCIceCandidatePairStats.retransmissionsSent - Web APIs
the rtcicecandidatepairstats dictionary's retransmissionssent property indicates the total number of stun connectivity check request retransmissions that have been sent so far on the pair of candidates.
... syntax retransmissionssent = rtcicecandidatepairstats.retransmissionssent; value an integer value indicating the total number of retransmitted stun connectivity check requests have been sent on the connection referenced by this candidate pair so far.
... specifications specification status comment identifiers for webrtc's statistics apithe definition of 'rtcicecandidatepairstats.retransmissionssent' in that specification.
... candidate recommendation initial specification.
RTCIceCandidatePairStats.totalRoundTripTime - Web APIs
the rtcicecandidatepairstats dictionary's totalroundtriptime property is the total time that has elapsed between sending stun requests and receiving the responses, for all such requests that have been made so far on the pair of candidates described by this rtcicecandidatepairstats object.
... syntax totalrtt = rtcicecandidatepairstats.totalroundtriptime; value this floating-point value indicates the total number of seconds which have elapsed between sending out stun connectivity and consent check requests and receiving their responses, for all such requests made so far on the connection described by this candidate pair.
... you can calculate the average round-trip time (rtt) by dividing this value by the value of the responsesreceived property: rtt = rtcicecandidatepairstats.totalroundtriptime / rtcicecandidatepairstats.responsesreceived; specifications specification status comment identifiers for webrtc's statistics apithe definition of 'rtcicecandidatepairstats.totalroundtriptime' in that specification.
... candidate recommendation initial specification.
RTCIceCandidatePairStats.transportId - Web APIs
the transportid property uniquely identifies the rtcicetransport that was inspected to obtain the transport-related statistics contained in the rtcicecandidatepairstats object.
... syntax transportid = rtcicecandidatepairstats.transportid; value a domstring which uniquely identifies the rtcicetransport object from which the transport-related data was obtained for the statistics contained in this rtcicecandidatepairstats object.
... specifications specification status comment identifiers for webrtc's statistics apithe definition of 'rtcicecandidatepairstats.transportid' in that specification.
... candidate recommendation initial specification.
RTCIceCandidateStats.address - Web APIs
the address property of the rtcicecandidatestats dictionary indicates the address of the ice candidate.
... syntax candidateaddress = rtcicecandidatestats.address; value either an ipv4 or ipv6 address or a fully-qualified domain name, which corresponds to the candidate.
... specifications specification status comment identifiers for webrtc's statistics apithe definition of 'rtcicecandidatestats.address' in that specification.
... candidate recommendation initial specification.
RTCIceCandidateStats.port - Web APIs
the rtcicecandidatestats dictionary's port property specifies the network port used by the candidate.
... syntax candidateport = rtcicecandidatestats.port; value an integer value indicating the network port used by the rtcicecandidate described by the rtcicecandidatestats object.
... specifications specification status comment identifiers for webrtc's statistics apithe definition of 'rtcicecandidatestats.port' in that specification.
... candidate recommendation initial specification.
RTCIceTcpCandidateType - Web APIs
the webrtc api's rtcicetcpcandidatetype enumerated type provides a set of domstring values representing the types of tcp candidates.
... usage notes the rtcicetcpcandidatetype type is used by the tcptype property of rtcicecandidate objects.
... specifications specification status comment webrtc 1.0: real-time communication between browsersthe definition of 'rtcicetcpcandidatetype' in that specification.
... candidate recommendation initial definition.
RTCPeerConnectionIceEvent.candidate - Web APIs
the read-only candidate property of the rtcpeerconnectioniceevent interface returns the rtcicecandidate associated with the event.
... syntax var candidate = event.candidate; value an rtcicecandidate object representing the ice candidate that has been received, or null to indicate that there are no further candidates for this negotiation session.
... example pc.onicecandidate = function( ev ) { alert("the ice candidate (transport address: '" + ev.candidate.candidate + "') has been added to this connection."); } specifications specification status comment webrtc 1.0: real-time communication between browsersthe definition of 'rtcpeerconnectioniceevent.candidate' in that specification.
... candidate recommendation initial specification.
Date - HTTP
WebHTTPHeadersDate
the date general http header contains the date and time at which the message was originated.
... note that date is listed in the forbidden header names in the fetch spec - so this code will not send date header: fetch('https://httpbin.org/get', { 'headers': { 'date': (new date()).toutcstring() } }) header type general header forbidden header name yes syntax date: <day-name>, <day> <month> <year> <hour>:<minute>:<second> gmt directives <day-name> one of "mon", "tue", "wed", "thu", "fri", "sat", or "sun" (case-sensitive).
...http dates are always expressed in gmt, never in local time.
... examples date: wed, 21 oct 2015 07:28:00 gmt new date().toutcstring() // "mon, 09 mar 2020 08:13:24 gmt" specifications specification title rfc 7231, section 7.1.1.2: date hypertext transfer protocol (http/1.1): semantics and content ...
Date.prototype.getFullYear() - JavaScript
the getfullyear() method returns the year of the specified date according to local time.
... syntax dateobj.getfullyear() return value a number corresponding to the year of the given date, according to local time.
...for dates between the years 1000 and 9999, getfullyear() returns a four-digit number, for example, 1995.
... var today = new date(); var year = today.getfullyear(); specifications specification ecmascript (ecma-262)the definition of 'date.prototype.getfullyear' in that specification.
Date.prototype.getHours() - JavaScript
the gethours() method returns the hour for the specified date, according to local time.
... syntax dateobj.gethours() return value an integer number, between 0 and 23, representing the hour for the given date according to local time.
... examples using gethours() the second statement below assigns the value 23 to the variable hours, based on the value of the date object xmas95.
... let xmas95 = new date('december 25, 1995 23:15:30'); let hours = xmas95.gethours(); console.log(hours); // 23 specifications specification ecmascript (ecma-262)the definition of 'date.prototype.gethours' in that specification.
Date.prototype.getMinutes() - JavaScript
the getminutes() method returns the minutes in the specified date according to local time.
... syntax dateobj.getminutes() return value an integer number, between 0 and 59, representing the minutes in the given date according to local time.
... examples using getminutes() the second statement below assigns the value 15 to the variable minutes, based on the value of the date object xmas95.
... var xmas95 = new date('december 25, 1995 23:15:30'); var minutes = xmas95.getminutes(); console.log(minutes); // 15 specifications specification ecmascript (ecma-262)the definition of 'date.prototype.getminutes' in that specification.
Date.prototype.getSeconds() - JavaScript
the getseconds() method returns the seconds in the specified date according to local time.
... syntax dateobj.getseconds() return value an integer number, between 0 and 59, representing the seconds in the given date according to local time.
... examples using getseconds() the second statement below assigns the value 30 to the variable seconds, based on the value of the date object xmas95.
... var xmas95 = new date('december 25, 1995 23:15:30'); var seconds = xmas95.getseconds(); console.log(seconds); // 30 specifications specification ecmascript (ecma-262)the definition of 'date.prototype.getseconds' in that specification.
Date.prototype.getTimezoneOffset() - JavaScript
syntax dateobj.gettimezoneoffset() return value a number representing the time-zone offset, in minutes, from the date based on current host system settings to utc.
... current locale utc-8 utc utc+3 return value 480 0 -180 the time zone offset returned is the one that applies for the date that it's called on.
... if the host system is configured for daylight saving, the offset will change depending on the date and time that the date represents and that daylight saving applies.
... examples using gettimezoneoffset() // get current timezone offset for host device let x = new date(); let currenttimezoneoffsetinhours = x.gettimezoneoffset() / 60; // 1 // get timezone offset for international labour day (may 1) in 2016 // be careful, the date() constructor uses 0-indexed months, so may is // represented with 4 (and not 5) let labourday = new date(2016, 4, 1) let labourdayoffset = labourday.gettimezoneoffset() / 60; specifications specification ecmascript (ecma-262)the definition of 'date.prototype.gettimezoneoffset' in that specification.
Date.prototype.getUTCDay() - JavaScript
the getutcday() method returns the day of the week in the specified date according to universal time, where 0 represents sunday.
... syntax dateobj.getutcday() return value an integer number corresponding to the day of the week for the given date, according to universal time: 0 for sunday, 1 for monday, 2 for tuesday, and so on.
... examples using getutcday() the following example assigns the weekday portion of the current date to the variable weekday.
... var today = new date(); var weekday = today.getutcday(); specifications specification ecmascript (ecma-262)the definition of 'date.prototype.getutcday' in that specification.
Date.prototype.getUTCMonth() - JavaScript
the getutcmonth() returns the month of the specified date according to universal time, as a zero-based value (where zero indicates the first month of the year).
... syntax dateobj.getutcmonth() return value an integer number, between 0 and 11, corresponding to the month of the given date according to universal time.
... examples using getutcmonth() the following example assigns the month portion of the current date to the variable month.
... var today = new date(); var month = today.getutcmonth(); specifications specification ecmascript (ecma-262)the definition of 'date.prototype.getutcmonth' in that specification.
Date.prototype.toISOString() - JavaScript
syntax dateobj.toisostring() return value a string representing the given date in the iso 8601 format according to universal time.
...engines which have not been updated to support this method can work around the absence of this method using the following shim: if (!date.prototype.toisostring) { (function() { function pad(number) { if (number < 10) { return '0' + number; } return number; } date.prototype.toisostring = function() { return this.getutcfullyear() + '-' + pad(this.getutcmonth() + 1) + '-' + pad(this.getutcdate()) + 't' + pad(this.getutchours()) + ':' + pad(this.getutcminutes()) + ':' + pad(this.getutcseconds()) + '.' + (this.getutcmilliseconds() / 1000).tofixed(3).slice(2, 5) + 'z'; }; })(); } examples using toisostring() let today ...
...= new date('05 october 2011 14:48 utc') console.log(today.toisostring()) // returns 2011-10-05t14:48:00.000z the above example uses parsing of a non–standard string value that may not be correctly parsed in non–mozilla browsers.
... specifications specification ecmascript (ecma-262)the definition of 'date.prototype.toisostring' in that specification.
Date.prototype.toUTCString() - JavaScript
the toutcstring() method converts a date to a string, using the utc time zone.
... syntax dateobj.toutcstring() return value a string representing the given date using the utc time zone.
...the most common return value was an rfc-1123 formatted date stamp, which is a slightly updated version of rfc-822 date stamps.
... examples using toutcstring() let today = new date('wed, 14 jun 2017 00:00:00 pdt'); let utcstring = today.toutcstring(); // wed, 14 jun 2017 07:00:00 gmt specifications specification ecmascript (ecma-262)the definition of 'date.prototype.toutcstring' in that specification.
Intl.DateTimeFormat.prototype.formatRange() - JavaScript
the intl.datetimeformat.prototype.formatrange() formats a date range in the most concise way based on the locale and options provided when instantiating intl.datetimeformat object.
... syntax intl.datetimeformat.prototype.formatrange(startdate, enddate) examples basic formatrange usage this method receives two dates and formats the date range in the most concise way based on the locale and options provided when instantiating intl.datetimeformat.
... let date1 = new date(date.utc(2007, 0, 10, 10, 0, 0)); let date2 = new date(date.utc(2007, 0, 10, 11, 0, 0)); let date3 = new date(date.utc(2007, 0, 20, 10, 0, 0)); // > 'wed, 10 jan 2007 10:00:00 gmt' // > 'wed, 10 jan 2007 11:00:00 gmt' // > 'sat, 20 jan 2007 10:00:00 gmt' let fmt1 = new intl.datetimeformat("en", { year: '2-digit', month: 'numeric', day: 'numeric', hour: 'numeric', minute: 'numeric' }); console.log(fmt1.format(date1)); console.log(fmt1.formatrange(date1, date2)); console.log(fmt1.formatrange(date1, date3)); // > '1/10/07, 10:00 am' // > '1/10/07, 10:00 – 11:00 am' // > '1/10/07, 10:00 am – 1/20/07, 10:00 am' let fmt2 = new intl.datetimeformat("en", { year: 'numeric', month: 'short', day: 'numeric' }); console.log(fmt2.format(date1)); c...
...onsole.log(fmt2.formatrange(date1, date2)); console.log(fmt2.formatrange(date1, date3)); // > 'jan 10, 2007' // > 'jan 10, 2007' // > 'jan 10 – 20, 2007' specifications specification intl.datetimeformat.formatrangethe definition of 'formatrange()' in that specification.
Intl.DateTimeFormat.prototype.formatRangeToParts() - JavaScript
the intl.datetimeformat.prototype.formatrangetoparts() method allows locale-specific tokens representing each part of the formatted date range produced by datetimeformat formatters.
... syntax intl.datetimeformat.prototype.formatrangetoparts(startdate, enddate) examples basic formatrangetoparts usage this method receives two dates and returns an array of objects containing the locale-specific tokens representing each part of the formatted date range.
... let date1 = new date(date.utc(2007, 0, 10, 10, 0, 0)); let date2 = new date(date.utc(2007, 0, 10, 11, 0, 0)); // > 'wed, 10 jan 2007 10:00:00 gmt' // > 'wed, 10 jan 2007 11:00:00 gmt' let fmt = new intl.datetimeformat("en", { hour: 'numeric', minute: 'numeric' }); console.log(fmt.formatrange(date1, date2)); // > '10:00 – 11:00 am' fmt.formatrangetoparts(date1, date2); // return value: // [ // { type: 'hour', value: '10', source: "startrange" }, // { type: 'literal', value: ':', source: "startrange" }, // { type: 'minute', value: '00', source: "startrange" }, // { type: 'literal', value: ' – ', source: "shared" }, // { type: 'hour', value: '11', source: "endrange" }, // { type: 'literal', value: ':', source: "endrange" }, // { typ...
...e: 'minute', value: '00', source: "endrange" }, // { type: 'literal', value: ' ', source: "shared" }, // { type: 'dayperiod', value: 'am', source: "shared" } // ] specifications specification intl.datetimeformat.formatrangethe definition of 'formatrangetoparts()' in that specification.
Intl.DateTimeFormat.prototype.resolvedOptions() - JavaScript
the intl.datetimeformat.prototype.resolvedoptions() method returns a new object with properties reflecting the locale and date and time formatting options computed during initialization of this datetimeformat object.
... syntax datetimeformat.resolvedoptions() return value a new object with properties reflecting the locale and date and time formatting options computed during the initialization of the given datetimeformat object.
... weekday era year month day hour minute second timezonename the values resulting from format matching between the corresponding properties in the options argument and the available combinations and representations for date-time formatting in the selected locale.
... examples using the resolvedoptions method var germanfakeregion = new intl.datetimeformat('de-xx', { timezone: 'utc' }); var usedoptions = germanfakeregion.resolvedoptions(); usedoptions.locale; // "de" usedoptions.calendar; // "gregory" usedoptions.numberingsystem; // "latn" usedoptions.timezone; // "utc" usedoptions.month; // "numeric" specifications specification ecmascript internationalization api (ecma-402)the definition of 'intl.datetimeformat.prototype.resolvedoptions' in that specification.
commandupdater - Archive of obsolete content
« xul reference home commandupdater type: boolean if true, the commandset is used for updating commands.
... typically, this is used to update menu commands such as undo and cut based on when an event occurs.
... for example, since the cut command is only valid when something is selected, a command updater might be used when the select event occurs.
datepicker.type - Archive of obsolete content
« xul reference home type type: one of the values below you can set the type attribute to one of the values below to specify the type of datepicker to use normal a datepicker with three fields for entering the year, month and date.
... grid a datepicker that displays a calendar grid where one month is shown at a time.
... popup a datepicker with three entry fields but an additional dropdown button, which, when pressed, will display a popup calendar grid.
Date and Time
this chapter describes the date and time functions in nspr.
... pr_msec_per_sec pr_usec_per_sec pr_nsec_per_sec pr_usec_per_msec pr_nsec_per_msec types and constants types and constants defined for nspr dates and times are: prtime prtimeparameters prexplodedtime time parameter callback functions in some geographic locations, use of daylight saving time (dst) and the rule for determining the dates on which dst starts and ends have changed a few times.
...two often-used callback functions of this type are provided by nspr: prtimeparamfn pr_localtimeparameters and pr_gmtparameters functions the functions that create and manipulate time and date values are: pr_now pr_explodetime pr_implodetime pr_normalizetime ...
JS_updateMallocCounter
syntax void js_updatemalloccounter(jscontext *cx, size_t nbytes); name type description cx jscontext * pointer to a js context to decrement the malloc counter.
... description js_updatemalloccounter decrements malloc counter of gc and the zone of the context.
... see also mxr id search for js_updatemalloccounter changeset 88cfae411a2a js_newruntime js_getgcparameter bug 517665 ...
AnimationEffect.updateTiming() - Web APIs
the updatetiming() method of the animationeffect interface updates the specified timing properties for an animation effect.
... syntax animation.updatetiming(timing); parameters timing an optionaleffecttiming object containing the timing properties to update.
... specifications specification status comment web animationsthe definition of 'animationeffect.updatetiming()' in that specification.
Element: compositionupdate event - Web APIs
the compositionupdate event is fired when a new character is received in the context of a text composition session controlled by a text composition system such as an input method editor.
... bubbles yes cancelable yes interface compositionevent event handler property none examples const inputelement = document.queryselector('input[type="text"]'); inputelement.addeventlistener('compositionupdate', (event) => { console.log(`generated characters were: ${event.data}`); }); live example html <div class="control"> <label for="name">on macos, click in the textbox below,<br> then type <kbd>option</kbd> + <kbd>`</kbd>, then <kbd>a</kbd>:</label> <input type="text" id="example" name="example"> </div> <div class="event-log"> <label>event log:</label> <textarea readonly class="event-log-contents" rows="8" cols="25"></texta...
...t log = document.queryselector('.event-log-contents'); const clearlog = document.queryselector('.clear-log'); clearlog.addeventlistener('click', () => { log.textcontent = ''; }); function handleevent(event) { log.textcontent = log.textcontent + `${event.type}: ${event.data}\n`; } inputelement.addeventlistener('compositionstart', handleevent); inputelement.addeventlistener('compositionupdate', handleevent); inputelement.addeventlistener('compositionend', handleevent); result specifications specification status ui events working draft ...
HTMLObjectElement.willValidate - Web APIs
the willvalidate read-only property of the htmlobjectelement interface returns a boolean that indicates whether the element is a candidate for constraint validation.
... syntax var boolean = htmlobjectelement.willvalidate; value a boolean.
... specifications specification status comment html living standardthe definition of 'willvalidate' in that specification.
MSCandidateWindowHide - Web APIs
mscandidatewindowhide fires after the input method editor (ime) candidate window closes and is fully hidden.
... syntax event property object.oncandidatewindowhide = handler; addeventlistener method object.addeventlistener("mscandidatewindowhide", handler, usecapture) nbsp; parameters pevtobj [in] type: ihtmleventobj pointer to an ihtmleventobj interface for the current event.
... the handler of this event will see that the iscandidatewindowvisible method returns false, and no clientrect object is returned from getcandidatewindowclientrect.
update() - Web APIs
the mediakeysession.update() method loads messages and licenses to the cdm, and then returns a promise .
... syntax mediakeysession.update(response).then(function() { ...
... specifications specification status comment encrypted media extensionsthe definition of 'update()' in that specification.
RTCIceCandidateInit.usernameFragment - Web APIs
the optional property usernamefragment in the rtcicecandidateinit dictionary specifies the value of the rtcicecandidate object's usernamefragment property.
... specifications specification status comment webrtc 1.0: real-time communication between browsersthe definition of 'rtcicecandidateinit.usernamefragment' in that specification.
... candidate recommendation initial specification.
ServiceWorkerRegistration.onupdatefound - Web APIs
the onupdatefound property of the serviceworkerregistration interface is an eventlistener property called whenever an event of type statechange is fired; it is fired any time the serviceworkerregistration.installing property acquires a new service worker.
... syntax serviceworkerregistration.onupdatefound = function() { ...
... }; specifications specification status comment service workersthe definition of 'serviceworkerregistration.onupdatefound' in that specification.
ServiceWorkerRegistration.update() - Web APIs
the update() method of the serviceworkerregistration interface attempts to update the service worker.
... syntax serviceworkerregistration.update(); parameters none.
... example the following simple example registers a service worker example then adds an event handler to a button so you can explicitly update the service worker whenever desired: if ('serviceworker' in navigator) { navigator.serviceworker.register('/sw-test/sw.js', {scope: 'sw-test'}).then(function(registration) { // registration worked console.log('registration succeeded.'); button.onclick = function() { registration.update(); } }).catch(function(error) { // registration failed console.log('registration failed with ' + error); }); }; specifications specification status comment service workersthe definition of 'serviceworkerregistration.update()' in th...
Window.updateCommands() - Web APIs
summary updates the state of commands of the current chrome window (ui).
... syntax window.updatecommands("scommandname") parameters scommandname is a particular string which describes what kind of update event this is (e.g.
... desktopmobilechromeedgefirefoxinternet exploreroperasafariandroid webviewchrome for androidfirefox for androidopera for androidsafari on iossamsung internetupdatecommands non-standardchrome no support noedge no support nofirefox full support yesie ?
<input type="datetime"> - HTML: Hypertext Markup Language
WebHTMLElementinputdatetime
the html <input type="datetime"> was a control for entering a date and time (hour, minute, second, and fraction of a second) as well as a timezone.
... instead, browsers are implementing (and developers are encouraged to use) <input type="datetime-local">.
... the format of the date and time value used by this input type is described in format of a valid global date and time string in date and time formats used in html.
Date.prototype.getMilliseconds() - JavaScript
the getmilliseconds() method returns the milliseconds in the specified date according to local time.
... syntax dateobj.getmilliseconds() return value a number, between 0 and 999, representing the milliseconds for the given date according to local time.
... examples using getmilliseconds() the following example assigns the milliseconds portion of the current time to the variable milliseconds: var today = new date(); var milliseconds = today.getmilliseconds(); specifications specification ecmascript (ecma-262)the definition of 'date.prototype.getmilliseconds' in that specification.
Date.prototype.getUTCFullYear() - JavaScript
the getutcfullyear() method returns the year in the specified date according to universal time.
... syntax dateobj.getutcfullyear() return value a number representing the year in the given date according to universal time.
... var today = new date(); var year = today.getutcfullyear(); specifications specification ecmascript (ecma-262)the definition of 'date.prototype.getutcfullyear' in that specification.
Date.prototype.getUTCHours() - JavaScript
the getutchours() method returns the hours in the specified date according to universal time.
... syntax dateobj.getutchours() return value an integer number, between 0 and 23, representing the hours in the given date according to universal time.
... var today = new date(); var hours = today.getutchours(); specifications specification ecmascript (ecma-262)the definition of 'date.prototype.getutchours' in that specification.
Date.prototype.getUTCMinutes() - JavaScript
the getutcminutes() method returns the minutes in the specified date according to universal time.
... syntax dateobj.getutcminutes() return value an integer number, between 0 and 59, representing the minutes in the given date according to universal time.
... var today = new date(); var minutes = today.getutcminutes(); specifications specification ecmascript (ecma-262)the definition of 'date.prototype.getutcminutes' in that specification.
Date.prototype.getUTCSeconds() - JavaScript
the getutcseconds() method returns the seconds in the specified date according to universal time.
... syntax dateobj.getutcseconds() return value an integer number, between 0 and 59, representing the seconds in the given date according to universal time.
... var today = new date(); var seconds = today.getutcseconds(); specifications specification ecmascript (ecma-262)the definition of 'date.prototype.getutcseconds' in that specification.
noupdate - Archive of obsolete content
the noupdate event is fired after checking for an application cache update, if the manifest hasn't changed.
... related events checking noupdate downloading progress cached updateready obsolete error ...
updateready - Archive of obsolete content
the updateready event is fired when the resources listed in the application cache manifest have been newly redownloaded, and the script can use swapcache() to switch to the new cache.
... related events checking noupdate downloading progress cached updateready obsolete error ...
oncommandupdate - Archive of obsolete content
« xul reference home oncommandupdate type: script code this event occurs when a command update occurs.
... you would use this to update the disabled status of items.
commandupdate - Archive of obsolete content
the commandupdate event is executed when a command update occurs on a <commandset>.
... this event would be used to update the disabled status of its commands.
date - Archive of obsolete content
ArchiveMozillaXULPropertydate
« xul reference date type: integer the currently selected date of the month from 1 to 31.
... set this property to change the selected date.
datepicker.open - Archive of obsolete content
« xul reference open type: boolean for popup type datepickers, specifies whether the popup is open.
...for non-popup datepickers, this property is always false.
datepicker.value - Archive of obsolete content
« xul reference value type: string the currently selected date in the form yyyy-mm-dd.
...set this property to change the selected date.
Debug.msUpdateAsyncCallbackRelation - Archive of obsolete content
the debug.msupdateasynccallbackrelation function updates the relationship status between a synchronous work item and the associated asynchronous operation.
... syntax debug.msupdateasynccallbackrelation(relatedasyncoperationid, relationtype) parameters relatedasyncoperationid the id associated with the asynchronous operation.
nsIGeolocationUpdate
method overview void update(in nsidomgeoposition position); methods update() notify the geolocation service that a new geolocation has been discovered.
...void update( in nsidomgeoposition position ); parameters position a nsidomgeoposition object describing the updated position information.
startSoftwareUpdate - Web APIs
method of installtrigger object syntax boolean startsoftwareupdate ( string url); parameters the startsoftwareupdate method has the following parameter: url a uniform resource locator specifying the location of the xpi file containing the software.
... description the startsoftwareupdate method triggers a software download and install from the specified url.
RTCIceCandidatePairStats.readable - Web APIs
the obsolete rtcicecandidatepairstats property readable reports whether or not the connection described by the candidate pair has received at least one valid incoming ice request.
... syntax isreadable = rtcicecandidatepairstats.readable; value a boolean value which is true if the connection described by this candidate pair has received at least one valid ice request, and is therefore ready to be read from.
RTCIceCandidatePairStats.writable - Web APIs
the obsolete rtcicecandidatepairstats property writable reports whether or not the connection described by the candidate pair is writable.
... syntax iswritable = rtcicecandidatepairstats.writable; value a boolean value which is true if the connection described by this candidate pair has received acknowledgement of receipt (ack) for at least one ice request and that stun consent hasn't expired.
RTCIceCandidateStats.mozLocalTransport - Web APIs
the non-standard mozilla extension to the rtcicecandidatestats dictionary, mozlocaltransport, has been supplanted by the standard relayprotocol property.
... syntax instead of using mozlocaltransport, you should use code like this: localtransport = rtcicecandidatestats.relayprotocol; specifications not part of any specification.
Date.prototype.getUTCMilliseconds() - JavaScript
syntax dateobj.getutcmilliseconds() return value an integer number, between 0 and 999, representing the milliseconds portion of the given date object.
... var today = new date(); var milliseconds = today.getutcmilliseconds(); specifications specification ecmascript (ecma-262)the definition of 'date.prototype.getutcmilliseconds' in that specification.
Date.prototype.toSource() - JavaScript
syntax dateobj.tosource() date.tosource() return value a string representing the source code of the given date object.
... examples native function for the built-in date object, tosource() returns the following string indicating that the source code is not available: function date() { [native code] } specifications not part of any standard.
InstallTrigger.startSoftwareUpdate - Archive of obsolete content
installtrigger.startsoftwareupdate this is a very simple example of the installtrigger object's principal method, startsoftwareupdate, which takes a string representing the path to the xpi and installs that xpi on the local machine.
datepicker.value - Archive of obsolete content
« xul reference home value type: string the initial value of the datepicker in the form yyyy-mm-dd.
validate - Archive of obsolete content
« xul reference home validate type: one of the values below this attribute indicates whether to load the image from the cache or not.
dateLeadingZero - Archive of obsolete content
« xul reference dateleadingzero type: boolean a read only value indicating whether a leading zero should be displayed before the date when it is less than 10.
dateValue - Archive of obsolete content
« xul reference datevalue type: date the date that is currently entered or selected in the datepicker as a date object.
Getting documentation updated
it may see periodical improvements or updates, and may eventually even be cleaned up (and de-archived) for better uxp focus, but for now, it's a historical snapshot for reference, not a living website.
Updates
please follow our monthly irc meeting for the latest updates.
nsIAccelerometerUpdate
xpcom/system/nsiaccelerometer.idlnot scriptable replaced by nsidevicemotionupdate 1.0 66 introduced gecko 2.0 obsolete gecko 6.0 inherits from: nsiaccelerometer last changed in gecko 5.0 (firefox 5.0 / thunderbird 5.0 / seamonkey 2.2) this method is only used in content tabs to receive nsiacceleration data from the chrome process.
Index - Web APIs
WebAPIIndex
33 addresserrors.dependentlocality api, addresserrors, error, locality, payment request, payment request api, property, read-only, reference, dependentlocality, payment an object based on addresserrors includes a dependentlocality property when the address's dependentlocality property couldn't be validated.
... 34 addresserrors.languagecode api, address, addresserrors, deprecated, language, languagecode, locale, payment request, payment request api, property, reference, payment an object based on addresserrors includes a languagecode property when the address's languagecode property couldn't be validated.
... 35 addresserrors.organization api, address, addresserrors, error, payment request, payment request api, property, read-only, reference, organization, payment an object based on addresserrors includes an organization property when the address's organization property couldn't be validated.
...And 237 more matches
Index - Archive of obsolete content
55 request needsupdate, sdk, add-on make simple network requests.
... 64 url add-on sdk construct, validate, and parse urls.
... 189 html to dom code snippets, dom, guide, html, intermediate, needsupdate although you can now natively parse html using domparser and xmlhttprequest, this is a new feature that is not yet supported by all browsers in use in the wild.
...And 101 more matches
Signaling and video calling - Web APIs
to allow the server to support signaling and ice negotiation, we need to update the code.
...the next task is to update the main websocket message handler to support doing so.
... exchanging ice candidates two peers need to exchange ice candidates to negotiate the actual connection between them.
...And 47 more matches
Index
MozillaTechXPCOMIndex
91 working with multiple versions of interfaces add-ons, extensions, xpcom in this short note we illustrate how one can update an xpcom module in order for it to work in both firefox 2 and firefox 3, even if the interfaces have changed in the interim.
... 99 avoiding leaks in javascript xpcom components add-ons, developing mozilla, extensions, mozilla, needsupdate, obsolete, xpcom, xpcom:language bindings, xpconnect programmers writing and reviewing javascript code in mozilla should understand how code using xpcom in javascript can leak so that they can avoid leaks.
... 109 setting up the gecko sdk needsupdate, tutorial, xpcom this chapter provides basic setup information for the gecko software development kit (sdk) used to build the weblock component in this tutorial.
...And 38 more matches
Linear-gradient Generator - CSS: Cascading Style Sheets
this.isvalidrgbvalue(blue) === false) return; this.r = red | 0; this.g = green | 0; this.b = blue | 0; if (this.isvalidrgbvalue(alpha) === true) this.a = alpha | 0; }; color.prototype.setbyname = function setbyname(name, value) { if (name === 'r' || name === 'g' || name === 'b') { if(this.isvalidrgbvalue(value) === false) return; this[name] = value; this.updatehsx(); } }; color.prototype.sethsv = function sethsv(hue, saturation, value) { this.hue = hue; this.saturation = saturation; this.value = value; this.hsvtorgb(); }; color.prototype.sethsl = function sethsl(hue, saturation, lightness) { this.hue = hue; this.saturation = saturation; this.lightness = lightness; this.hsltorgb(); }; color.prototype.sethue = function sethue(va...
...lue) { if (typeof(value) !== 'number' || isnan(value) === true || value < 0 || value > 359) return; this.hue = value; this.updatergb(); }; color.prototype.setsaturation = function setsaturation(value) { if (typeof(value) !== 'number' || isnan(value) === true || value < 0 || value > 100) return; this.saturation = value; this.updatergb(); }; color.prototype.setvalue = function setvalue(value) { if (typeof(value) !== 'number' || isnan(value) === true || value < 0 || value > 100) return; this.value = value; this.hsvtorgb(); }; color.prototype.setlightness = function setlightness(value) { if (typeof(value) !== 'number' || isnan(value) === true || value < 0 || value > 100) return; this.lightness = value; this.hsltorgb(); }; color.prototype.
... this.alpha = 1; this.rgbtohsv(); }; /*========== conversion methods ==========*/ color.prototype.converttohsl = function converttohsl() { if (this.format === 'hsl') return; this.setformat('hsl'); this.rgbtohsl(); }; color.prototype.converttohsv = function converttohsv() { if (this.format === 'hsv') return; this.setformat('hsv'); this.rgbtohsv(); }; /*========== update methods ==========*/ color.prototype.updatergb = function updatergb() { if (this.format === 'hsv') { this.hsvtorgb(); return; } if (this.format === 'hsl') { this.hsltorgb(); return; } }; color.prototype.updatehsx = function updatehsx() { if (this.format === 'hsv') { this.rgbtohsv(); return; } if (this.format === 'hsl') { this.rgbtohsl(); return; } }...
...And 38 more matches
Anatomy of a video game - Game development
these games present two images to the user; they accept their click (or touch); they interpret the input as a success, failure, pause, menu interaction, etc.; finally, they calculate an updated scene resulting from that input.
...this is more of a turn-based approach that doesn't demand a constant update every frame, only when the player reacts.
...the date object is no longer the recognised method for timing events because it is very imprecise and can be modified by the system clock.
...And 36 more matches
RTCPeerConnection - Web APIs
nchor="middle" alignment-baseline="middle">rtcpeerconnection</text></a></svg></div> a:hover text { fill: #0095dd; pointer-events: all;} constructorrtcpeerconnection() the rtcpeerconnection() constructor returns a newly-created rtcpeerconnection, which represents a connection between the local device and a remote peer.propertiesalso inherits properties from: eventtargetcantrickleicecandidatesthe read-only rtcpeerconnection property cantrickleicecandidates returns a boolean which indicates whether or not the remote peer can accept trickled ice candidates.connectionstate the read-only connectionstate property of the rtcpeerconnection interface indicates the current state of the peer connection by returning one of the string values specified by the enum rtcpeerconnectionstate.currentlo...
...also included is a list of any ice candidates that may already have been generated by the ice agent since the offer or answer represented by the description was first instantiated.currentremotedescription read only the read-only property rtcpeerconnection.currentremotedescription returns an rtcsessiondescription object describing the remote end of the connection as it was most recently successfully negotiated since the last time the rtcpeerconnection finished negotiating and connec...
...also included is a list of any ice candidates that may already have been generated by the ice agent since the offer or answer represented by the description was first instantiated.getdefaulticeservers() the getdefaulticeservers() method of the rtcpeerconnection interface returns an array of objects based on the rtciceserver dictionary, which indicates what, if any, ice servers the browser will use by default if none are provided to the rtcpeerconnection in its rtcconfiguration.
...And 36 more matches
Color picker tool - CSS: Cascading Style Sheets
this.isvalidrgbvalue(blue) === false) return; this.r = red | 0; this.g = green | 0; this.b = blue | 0; if (this.isvalidrgbvalue(alpha) === true) this.a = alpha | 0; }; color.prototype.setbyname = function setbyname(name, value) { if (name === 'r' || name === 'g' || name === 'b') { if(this.isvalidrgbvalue(value) === false) return; this[name] = value; this.updatehsx(); } }; color.prototype.sethsv = function sethsv(hue, saturation, value) { this.hue = hue; this.saturation = saturation; this.value = value; this.hsvtorgb(); }; color.prototype.sethsl = function sethsl(hue, saturation, lightness) { this.hue = hue; this.saturation = saturation; this.lightness = lightness; this.hsltorgb(); }; color.prototype.sethue = function sethue(va...
...lue) { if (typeof(value) !== 'number' || isnan(value) === true || value < 0 || value > 359) return; this.hue = value; this.updatergb(); }; color.prototype.setsaturation = function setsaturation(value) { if (typeof(value) !== 'number' || isnan(value) === true || value < 0 || value > 100) return; this.saturation = value; this.updatergb(); }; color.prototype.setvalue = function setvalue(value) { if (typeof(value) !== 'number' || isnan(value) === true || value < 0 || value > 100) return; this.value = value; this.hsvtorgb(); }; color.prototype.setlightness = function setlightness(value) { if (typeof(value) !== 'number' || isnan(value) === true || value < 0 || value > 100) return; this.lightness = value; this.hsltorgb(); }; color.prototype.
... this.alpha = 1; this.rgbtohsv(); }; /*========== conversion methods ==========*/ color.prototype.converttohsl = function converttohsl() { if (this.format === 'hsl') return; this.setformat('hsl'); this.rgbtohsl(); }; color.prototype.converttohsv = function converttohsv() { if (this.format === 'hsv') return; this.setformat('hsv'); this.rgbtohsv(); }; /*========== update methods ==========*/ color.prototype.updatergb = function updatergb() { if (this.format === 'hsv') { this.hsvtorgb(); return; } if (this.format === 'hsl') { this.hsltorgb(); return; } }; color.prototype.updatehsx = function updatehsx() { if (this.format === 'hsv') { this.rgbtohsv(); return; } if (this.format === 'hsl') { this.rgbtohsl(); return; } }...
...And 32 more matches
Index
there is a classic engine that is very stable and works fine in all simple scenarios, for example if all (b) candidate issuer certificates have the same subject and issuer names and differ by validity period; however, it works only in a limited amount of more advanced scenarios.
...as a result, when searching for a trust path from (a) to a trusted anchor (root) certificate (z), the set of candidate issuer certificates might have different issuer names (referring to the second or higher issuer level).
...create a context handle while providing all the parameters required for the operation, then call an “update” function multiple times to pass subsets of the input to nss.
...And 30 more matches
Componentizing our Svelte app - Learn web development
we'll componentize our app, then add more functionality to allow users to update existing components.
...you'll notice that when you click on the filter buttons, they are selected and the style updates appropriately.
... we will just declare the onclick prop assigning a dummy handler to prevent errors, like this: export let onclick = (clicked) => {} and we'll declare the following reactive statement — $: onclick(filter) — to call the onclick handler whenever the filter variable is updated.
...And 29 more matches
<input>: The Input (Form Input) element - HTML: Hypertext Markup Language
WebHTMLElementinput
<input type="color" name="color"/> html5 date a control for entering a date (year, month, and day, with no time).
... opens a date picker or numeric wheels for year, month, day when active in supporting browsers.
... <input type="date" name="date"/> html5 datetime-local a control for entering a date and time, with no time zone.
...And 29 more matches
Advanced Svelte: Reactivity, lifecycle, accessibility - Learn web development
update your existing checkalltodos() function to the following: const checkalltodos = (completed) => { todos.foreach(t => t.completed = completed) console.log('todos', todos) } go back to your browser, open your devtools console, and click check all/uncheck all a few times.
... you'll notice that the array is successfully updated every time you press the button (the todo objects' completed properties are toggled between true and false), but svelte is not aware of that.
... many web frameworks use the virtual dom technique to update the page.
...And 26 more matches
Working with Svelte stores - Learn web development
remember that we can access top-level variables from the markup, and whenever they are modified the dom will update accordingly.
...in the callback function we just assign the value we receive to the local variable, which will trigger the update of the component's dom.
...there we assign a new value to a local variable, and thanks to svelte reactivity all our markup and reactive dependencies are updated accordingly.
...And 25 more matches
Dynamic behavior in Svelte: working with variables and props - Learn web development
observe how the numbers in the message are updated appropriately.
...this would allow us to save them to a web service or local storage and later retrieve them for update.
...update src/app.svelte as follows: <script> import todos from './components/todos.svelte' let todos = [ { id: 1, name: 'create a svelte starter app', completed: true }, { id: 2, name: 'create your first component', completed: true }, { id: 3, name: 'complete the rest of the tutorial', completed: false } ] </script> <todos todos={todos} /> when the attribute and the variable...
...And 25 more matches
TypeScript support in Svelte - Learn web development
just take into account that the svelte community is constantly improving svelte typescript support, so you should run npm update regularly to take advantage of the latest changes.
...you'll also have to update any corresponding import statements (don't include the .ts in your import statements; typescript chose to omit the extensions).
...for example, if you start adding an ms property to the alert component call, typescript will infer from the default value that the ms property should be a number: and if you pass something that is not a number it will complain about it: the application template has a validate script configured that runs svelte-check against your code.
...And 24 more matches
Application cache implementation overview
when the url in the manifest attribute of the html tag is identical to the manifest url the channel's nsiapplicationcache object belongs to and, the channel's loadedfromapplicationcache flag is set, the document is associated with that nsiapplicationcache object and an update attempt for the manifest is scheduled after the document completely loads.
...updating an existing cache or first download of an offline cache the process of updating or first caching is invoked asynchronously from nscontentsink::processofflinemanifest() using nsofflinecacheupdateservice.
... the implementation of offline cache update is in /uriloader/prefetch.
...And 23 more matches
Background Tasks API - Web APIs
this code draws any pending updates to the document currently being displayed, runs any javascript code the page needs to run, accepts events from input devices, and dispatches those events to the elements that should receive them.
... in addition, the event loop handles interactions with the operating system, updates to the browser's own user interface, and so forth.
... because event handling and screen updates are two of the most obvious ways users notice performance issues, it's important for your code to be a good citizen of the web and help to prevent stalls in the execution of the event loop.
...And 23 more matches
WebRTC connectivity - Web APIs
after setlocaldescription(), the caller asks stun servers to generate the ice candidates the caller uses the signaling server to transmit the offer to the intended receiver of the call.
... the pendinglocaldescription contains not just the offer or answer under consideration, but any local ice candidates which have already been gathered since the offer or answer was created.
... similarly, pendingremotedescription includes any remote ice candidates which have been provided by calls to rtcpeerconnection.addicecandidate().
...And 23 more matches
Setting up your own test automation environment - Learn web development
objective: to show how to set up a selenium testing environment locally and run tests with it, and how to integrate it with tools like lambdatest, sauce labs, and browserstack.
...we are going to choose selenium's official selenium-webdriver, as the documentation seems fairly up-to-date and it is well-maintained.
...you should make sure that everything is up-to-date.
...And 22 more matches
Box-shadow generator - CSS: Cascading Style Sheets
true : false; this.topic = topic; this.node = node; var pointer = document.createelement('div'); pointer.classname = 'ui-slider-pointer'; node.appendchild(pointer); this.pointer = pointer; setmousetracking(node, updateslider.bind(this)); sliders[topic] = this; setvalue(topic, this.value); } var setbuttoncomponent = function setbuttoncomponent(node) { var type = node.getattribute('data-type'); var topic = node.getattribute('data-topic'); if (type === "sub") { node.textcontent = '-'; node.addeventlistener("click", function() { decrement(topic); }); } if (type === "add") { node.te...
...slider.step; setvalue(slider.topic, slider.value) notify.call(slider); } }; var decrement = function decrement(topic) { var slider = sliders[topic]; if (slider === null || slider === undefined) return; if (slider.value - slider.step >= slider.min) { slider.value -= slider.step; setvalue(topic, slider.value) notify.call(slider); } } // this = slider object var updateslider = function updateslider(e) { var node = this.node; var pos = e.pagex - node.offsetleft; var width = node.clientwidth; var delta = this.max - this.min; var offset = this.pointer.clientwidth + 4; // border width * 2 if (pos < 0) pos = 0; if (pos > width) pos = width; var value = pos * delta / width | 0; var precision = value % this.step; value = value - precision + this.
...g = green | 0; if (blue != undefined) this.b = blue | 0; if (alpha != undefined) this.a = alpha | 0; } /** * hsv/hsb (hue, saturation, value / brightness) * @param hue 0-360 * @param saturation 0-100 * @param value 0-100 */ color.prototype.sethsv = function sethsv(hue, saturation, value) { this.hue = hue; this.saturation = saturation; this.value = value; this.updatergb(); } color.prototype.updatergb = function updatergb() { var sat = this.saturation / 100; var value = this.value / 100; var c = sat * value; var h = this.hue / 60; var x = c * (1 - math.abs(h % 2 - 1)); var m = value - c; var precision = 255; c = (c + m) * precision; x = (x + m) * precision; m = m * precision; if (h >= 0 && h < 1) { this.setrgba(c, x, m); return; } ...
...And 22 more matches
Install Manifests - Archive of obsolete content
it contains metadata identifying the add-on, providing information about who created it, where more information can be found about it, which versions of what applications it is compatible with, how it should be updated, and so on.
... note: extensions compatible with firefox 3.5 should specify a maxversion of 3.5.*, so that they are automatically compatible with security and stability updates.
... for firefox/thunderbird 1.0, the format must conform to the rules specified in extension versioning, update and compatibility.
...And 21 more matches
WAI-ARIA basics - Learn web development
previous overview: accessibility next following on from the previous article, sometimes making complex ui controls that involve unsemantic html and dynamic javascript-updated content can be difficult.
... as another example, apps started to feature complex controls like date pickers for choosing dates, sliders for choosing values, etc.
... html5 provides special input types to render such controls: <input type="date"> <input type="range"> these are not well-supported across browsers, and it is also difficult to style them, making them not very useful for integrating with website designs.
...And 21 more matches
Package management basics - Learn web development
previous overview: understanding client-side tools next in this article we'll look at package managers in some detail to understand how we can use them in our own projects — to install project tool dependencies, keep them up-to-date, and more.
... a simple example of a useful dependency that your project might need is some code to calculate relative dates as human-readable text.
... a project dependency can be an entire javascript library or framework — such as react or vue — or a very small utility like our human-readable date library, or it can be a command line tool such as prettier or eslint, which we talked about in previous articles.
...And 21 more matches
Index - Archive of obsolete content
ArchiveMozillaXULIndex
67 commandupdater xul attributes, xul reference no summary!
... 85 datepicker.type xul attributes, xul reference no summary!
... 86 datepicker.value xul attributes, xul reference no summary!
...And 20 more matches
React interactivity: Events and state - Learn web development
your <form /> component call should be updated as follows: <form addtask={addtask} /> finally, you can use this prop inside the handlesubmit() function in your <form /> component!
... update it as follows: function handlesubmit(e) { e.preventdefault(); props.addtask("say hello!"); } clicking on the "add" button in your browser will prove that the addtask() callback function works, but it'd be nice if we could get the alert to show us what we're typing in our input field!
...now that we're dealing with user input and data updates, however, we need something more.
...And 20 more matches
nsINavBookmarksService
to use this service, use: var navbookmarksservice = components.classes["@mozilla.org/browser/nav-bookmarks-service;1"] .getservice(components.interfaces.nsinavbookmarksservice); method overview void addobserver(in nsinavbookmarkobserver observer, in boolean ownsweak); void beginupdatebatch(); obsolete since gecko 1.9 void changebookmarkuri(in long long aitemid, in nsiuri anewuri); long long createdynamiccontainer(in long long aparentfolder, in autf8string aname, in astring acontractid, in long aindex); note: renamed from createcontainer in gecko 1.9 obsolete since gecko 13.0 long long createfolder(in long long aparentfolder, in autf8string name, in l...
...ong index); void endupdatebatch(); obsolete since gecko 1.9 void exportbookmarkshtml(in nsifile file); obsolete since gecko 1.9 nsiuri getbookmarkedurifor(in nsiuri auri); void getbookmarkfolderstarray(in nsiuri auri, in print64array aresult); native code only!
...er); obsolete since gecko 2.0 long long getfolderidforitem(in long long aitemid); boolean getfolderreadonly(in long long aitemid); astring getfoldertitle(in print64 folder); obsolete since gecko 1.9 nsiuri getfolderuri(in print64 folder); obsolete since gecko 1.9 long long getidforitemat(in long long aparentid, in long aindex); prtime getitemdateadded(in long long aitemid); astring getitemguid(in long long aitemid); obsolete since gecko 14.0 long long getitemidforguid(in astring aguid); obsolete since gecko 14.0 long getitemindex(in long long aitemid); prtime getitemlastmodified(in long long aitemid); autf8string getitemtitle(in long long aitemid); unsigned short getitemtype(in lo...
...And 20 more matches
Python binding for NSS
release information release 1.0.1 release date 2017-02-28 scm tag pynss_release_1_0_1 source download https://ftp.mozilla.org/pub/mozilla.org/security/python-nss/releases/pynss_release_1_0_1/src/ change log add tls 1.3 cipher suites ssl_cipher_info.py now attempts to enable tls 1.3 fix build issue in setup.py.
...`pip wheel -w dist .` the following constants were added: ssl.tls_aes_128_gcm_sha256 ssl.tls_aes_256_gcm_sha384 ssl.tls_chacha20_poly1305_sha256 release 1.0.0 release date 2016-09-01 scm tag pynss_release_1_0_0 source download https://ftp.mozilla.org/pub/mozilla.org/security/python-nss/releases/pynss_release_1_0_0/src/ change log official 1.0.0 release, only minor tweaks from the 1.0.0beta1 release.
... the following constants were added: ssl.tls_ecdhe_rsa_with_chacha20_poly1305_sha256 ssl.tls_ecdhe_ecdsa_with_chacha20_poly1305_sha256 ssl.tls_dhe_rsa_with_chacha20_poly1305_sha256 ssl.tls_ecdhe_psk_with_chacha20_poly1305_sha256 ssl.tls_dhe_psk_with_chacha20_poly1305_sha256 release 1.0.0beta1 release date 2016-02-16 scm tag pynss_release_1_0_0beta1 source download https://ftp.mozilla.org/pub/mozilla.org/security/python-nss/releases/pynss_release_1_0_0beta1/src/ change log the primary enhancement in this version is support for python3.
...And 19 more matches
Drawing and Event Handling - Plugins
npn_invalidaterect: invalidate an area in a windowless plug-in before repainting or refreshing.
... npn_invalidateregion: invalidate a region in a windowless plug-in before repainting or refreshing.
...the browser sets up the port for the plug-in before passing the plug-in an update event in two ways: the browser calls setorigin(npport->portx, npport->porty).
...And 18 more matches
AddressErrors - Web APIs
addresserrors is the type of the object returned by shippingaddresserrors in the paymentdetailsupdate passed into paymentrequestupdateevent.updatewith() by the shippingaddresschange event handler if a change to the address resulted in a validation error occurring.
... properties addressline a domstring which, if present, indicates that the addressline property of the paymentaddress could not be validated.
... city a domstring which, if present, indicates that the city property of the paymentaddress could not be validated.
...And 18 more matches
Introduction to SSL - Archive of obsolete content
the client and the server use the session keys to encrypt and decrypt the data they send to each other and to validate its integrity.
...the public key in the client's certificate can correctly validate the digital signature only if the corresponding private key was used.
... otherwise, the server cannot validate the digital signature and the session is terminated.
...And 17 more matches
IME handling guide
ecompositionupdate this is dispatched by textcomposition when an ecompoitionchange will change the composition string.
... this represents a dom compositionupdate event.
... mranges representing dom event ecompositionstart selected string before starting composition textcomposition nullptr compositionstart ecompositionupdate new composition string textcomposition nullptr compositionupdate ecompositionend commit string textcomposition nullptr compositionend ecompositionchange new composition string widget (or textcomposition) must not be nullptr text ecompositioncommitasis n/a (must be empty) nobody nullptr none ecompositioncommit c...
...And 17 more matches
<input type="month"> - HTML: Hypertext Markup Language
WebHTMLElementinputmonth
clicking the down arrow on the right hand side brings up a date picker that lets you select the month and year.
...the format of the month string used by this input type is described in format of a valid local month string in date and time formats used in html.
... you can set a default value for the input control by including a month and year inside the value attribute, like so: <label for="bday-month">what month were you born in?</label> <input id="bday-month" type="month" name="bday-month" value="2017-06"> one thing to note is that the displayed date format differs from the actual value; most user agents display the month and year in a locale-appropriate form, based on the set locale of the user's operating system, whereas the date value is always formatted yyyy-mm.
...And 17 more matches
CSS3 - Archive of obsolete content
css fonts module level 3 candidate recommendation since september 20th, 2018 amends the css2.1 font matching algorithm to be closer to what is really implemented.
... stable modules a few css modules are already fairly stable and have reached one of the three recommendation level of the csswg: candidate recommendation, proposed recommendation or recommendation.
... these can be used without prefix and are pretty stable, though a few features can still be dropped at the candidate recommendation stage.
...And 16 more matches
XForms Input Element - Archive of obsolete content
(xhtml/xul) datepicker - used to represent data of type xsd:date (xhtml/xul) calendar - used to represent data of type xsd:date when appearance attribute also has the value 'full' (xhtml/xul) month list - used to represent data of type xsd:gmonth (xhtml only) days list - used to represent data of type xsd:gday (xhtml only) number field - used to represent data of numeric type (fx 3.0 only, xul only) more detail ...
...analogous widgets are <xhtml:input type="text"/> and <xul:textbox/> specific handling of attributes incremental - if "true", the bound instance node will be updated on each character typed by the user.
... if "false", or the incremental attribute is omitted on this element then the bound instance node will be updated when the control loses the focus.
...And 16 more matches
RTCConfiguration - Web APIs
properties bundlepolicy optional specifies how to handle negotiation of candidates when the remote peer is not compatible with the sdp bundle standard.
... icecandidatepoolsize optional an unsigned 16-bit integer value which specifies the size of the prefetched ice candidate pool.
... the default value is 0 (meaning no candidate prefetching will occur).
...And 16 more matches
Using DTMF with WebRTC - Web APIs
each time a tone is sent, the rtcpeerconnection receives a tonechange event with a tone property specifying which tone finished playing, which is an opportunity to update interface elements, for example.
... function connectanddial() { callerpc = new rtcpeerconnection(); hasaddtrack = (callerpc.addtrack !== undefined); callerpc.onicecandidate = handlecallericeevent; callerpc.onnegotiationneeded = handlecallernegotiationneeded; callerpc.oniceconnectionstatechange = handlecallericeconnectionstatechange; callerpc.onsignalingstatechange = handlecallersignalingstatechangeevent; callerpc.onicegatheringstatechange = handlecallergatheringstatechangeevent; receiverpc = new rtcpeerconnection(); receiverpc.onicecandidate = handlerec...
... then a second rtcpeerconnection, this one representing the receiving end of the call, is created and stored in receiverpc; its onicecandidate event handler is set up too.
...And 16 more matches
Updating Commands - Archive of obsolete content
« previousnext » in this section, we will look at how to update commands.
...the only other thing you need to do is ensure that the enabled status of the paste command, and therefore the button, is updated at the right time, which is described below.
... command updaters a command updater is a feature of the commandset element which allows it to update commands when certain events happen.
...And 15 more matches
Theme changes in Firefox 2 - Archive of obsolete content
this article covers the changes that need to be made to update a firefox theme to work properly in firefox 2.
... browser changes requiring theme updates there are a number of changed and deleted files in the browser that may require you to make changes to your theme.
... the table lists both the changed xul file and the theme's corresponding css file that you might need to update.
...And 15 more matches
Advanced text formatting - Learn web development
{ margin: 0; text-align: right; font-size: 0.7rem; width: 98%; } body { margin: 10px; background: #f5f9fa; } const textarea = document.getelementbyid('code'); const reset = document.getelementbyid('reset'); const solution = document.getelementbyid('solution'); const output = document.queryselector('.output'); const code = textarea.value; const userentry = textarea.value; function updatecode() { output.innerhtml = textarea.value; } reset.addeventlistener('click', function() { textarea.value = code; userentry = textarea.value; solutionentry = htmlsolution; solution.value = 'show solution'; updatecode(); }); solution.addeventlistener('click', function() { if(solution.value === 'show solution') { textarea.value = solutionentry; solution.value = 'hide solution...
...'; } else { textarea.value = userentry; solution.value = 'show solution'; } updatecode(); }); const htmlsolution = '<dl>\n <dt>bacon</dt>\n <dd>the glue that binds the world together.</dd>\n <dt>eggs</dt>\n <dd>the glue that binds the cake together.</dd>\n <dt>coffee</dt>\n <dd>the drink that gets the world running in the morning.</dd>\n <dd>a light brown color.</dd>\n</dl>'; const solutionentry = htmlsolution; textarea.addeventlistener('input', updatecode); window.addeventlistener('load', updatecode); // stop tab key tabbing out of textarea and // make it write a tab at the caret position instead textarea.onkeydown = function(e){ if (e.keycode === 9) { e.preventdefault(); insertatcaret('\t'); } if (e.keycode === 27) { textarea.blur(); } }; function inse...
...nst caretpos = textarea.selectionstart; const front = (textarea.value).substring(0, caretpos); const back = (textarea.value).substring(textarea.selectionend, textarea.value.length); textarea.value = front + text + back; caretpos = caretpos + text.length; textarea.selectionstart = caretpos; textarea.selectionend = caretpos; textarea.focus(); textarea.scrolltop = scrollpos; } // update the saved usercode every time the user updates the text area code textarea.onkeyup = function(){ // we only want to save the state when the user code is being shown, // not the solution, so that solution is not saved over the user code if(solution.value === 'show solution') { userentry = textarea.value; } else { solutionentry = textarea.value; } updatecode(); }; quotatio...
...And 15 more matches
NSS functions
updated - function has new arguments such as new flag or addition to structure.
... ssl_getclientauthdatahook mxr 3.2 and later ssl_getmaxservercachelocks mxr 3.4 and later ssl_getsessionid mxr 3.2 and later ssl_getstatistics mxr 3.2 and later ssl_handshakecallback mxr 3.2 and later ssl_importfd mxr 3.2 and later ssl_inheritmpserversidcache mxr 3.2 and later ssl_invalidatesession mxr 3.2 and later ssl_localcertificate mxr 3.4 and later ssl_optionget mxr 3.2 and later ssl_optiongetdefault mxr 3.2 and later ssl_optionset mxr 3.2 and later ssl_optionsetdefault mxr 3.2 and later ssl_peercertificate mxr 3.2 and later ssl_preencryptedfiletostream mxr 3.2 and lat...
...updated 3.8 with new options.
...And 15 more matches
Checking when a deadline is due - Web APIs
in this article we look at a complex example involving checking the current time and date against a deadline stored via indexeddb.
... the main complication here is checking the stored deadline info (month, hour, day, etc.) against the current time and date taken from a date object.
... the main example application we will be referring to in this article is to-do list notifications, a simple to-do list application that stores task titles and deadline times and dates via indexeddb, and then provides users with notifications when deadline dates are reached, via the notification, and vibration apis.
...And 15 more matches
Establishing a connection: The WebRTC perfect negotiation pattern - Web APIs
because webrtc doesn't mandate a specific transport mechanism for signaling during the negotiation of a new peer connection, it's highly flexible.
... handling incoming ice candidates next, we need to handle the rtcpeerconnection event icecandidate, which is how the local ice layer passes candidates to us for delivery to the remote peer over the signaling channel.
... pc.onicecandidate = ({candidate}) => signaler.send({candidate}); this simply takes the candidate member of this ice event and passes it through to the signaling channel's send() method to be sent over the signaling server to the remote peer.
...And 15 more matches
ARIA live regions - Accessibility
using javascript, it is possible to dynamically change parts of a page without requiring the entire page to reload — for instance, to update a list of search results on the fly, or to display a discreet alert or notification which does not require user interaction.
... simple live regions dynamic content which updates without a page reload is generally either a region or a widget.
... aria-live: the aria-live=politeness_setting is used to set the priority with which screen reader should treat updates to live regions - the possible settings are: off, polite or assertive.
...And 15 more matches
JXON - Archive of obsolete content
|*| http://www.gnu.org/licenses/gpl-3.0-standalone.html |*| \*/ function parsetext (svalue) { if (/^\s*$/.test(svalue)) { return null; } if (/^(?:true|false)$/i.test(svalue)) { return svalue.tolowercase() === "true"; } if (isfinite(svalue)) { return parsefloat(svalue); } if (isfinite(date.parse(svalue))) { return new date(svalue); } return svalue; } function jxontree (oxmlparent) { var nattrlen = 0, nlength = 0, scollectedtxt = ""; if (oxmlparent.haschildnodes()) { for (var onode, sprop, vcontent, nitem = 0; nitem < oxmlparent.childnodes.length; nitem++) { onode = oxmlparent.childnodes.item(nitem); if ((onode.nodetype - 1 | 1) === 3) { scollectedtxt += onode...
... }], "purchased": { "keyvalue": null }, "keyvalue": null, "keyattributes": { "description": "large" } }], "keyvalue": null, "keyattributes": { "gender": "men's" } }, { "item_number": { "keyvalue": "rrx9856" }, "discount_until": { "keyvalue": new date(1995, 11, 25) }, "price": { "keyvalue": 42.5 }, "size": { "color_swatch": { "keyvalue": "black", "keyattributes": { "image": "black_cardigan.jpg" } }, "keyvalue": null, "keyattributes": { "description": "medium" } }, "keyvalue": null, "key...
...|*| http://www.gnu.org/licenses/gpl-3.0-standalone.html |*| \*/ function parsetext (svalue) { if (/^\s*$/.test(svalue)) { return null; } if (/^(?:true|false)$/i.test(svalue)) { return svalue.tolowercase() === "true"; } if (isfinite(svalue)) { return parsefloat(svalue); } if (isfinite(date.parse(svalue))) { return new date(svalue); } return svalue; } function jxontree (oxmlparent) { if (oxmlparent.haschildnodes()) { var scollectedtxt = ""; for (var onode, sprop, vcontent, nitem = 0; nitem < oxmlparent.childnodes.length; nitem++) { onode = oxmlparent.childnodes.item(nitem); if ((onode.nodetype - 1 | 1) === 3) { scollectedtxt += onode.nodetype === 3 ?
...And 14 more matches
HTML text fundamentals - Learn web development
.a11y-label { margin: 0; text-align: right; font-size: 0.7rem; width: 98%; } body { margin: 10px; background: #f5f9fa; } var textarea = document.getelementbyid('code'); var reset = document.getelementbyid('reset'); var solution = document.getelementbyid('solution'); var output = document.queryselector('.output'); var code = textarea.value; var userentry = textarea.value; function updatecode() { output.innerhtml = textarea.value; } reset.addeventlistener('click', function() { textarea.value = code; userentry = textarea.value; solutionentry = htmlsolution; solution.value = 'show solution'; updatecode(); }); solution.addeventlistener('click', function() { if(solution.value === 'show solution') { textarea.value = solutionentry; solution.value = 'hide solution...
...'; } else { textarea.value = userentry; solution.value = 'show solution'; } updatecode(); }); var htmlsolution = '<h1>my short story</h1>\n<p>i am a statistician and my name is trish.</p>\n<p>my legs are made of cardboard and i am married to a fish.</p>'; var solutionentry = htmlsolution; textarea.addeventlistener('input', updatecode); window.addeventlistener('load', updatecode); // stop tab key tabbing out of textarea and // make it write a tab at the caret position instead textarea.onkeydown = function(e){ if (e.keycode === 9) { e.preventdefault(); insertatcaret('\t'); } if (e.keycode === 27) { textarea.blur(); } }; function insertatcaret(text) { var scrollpos = textarea.scrolltop; var caretpos = textarea.selectionstart; var front = (textarea.va...
...lue).substring(0, caretpos); var back = (textarea.value).substring(textarea.selectionend, textarea.value.length); textarea.value = front + text + back; caretpos = caretpos + text.length; textarea.selectionstart = caretpos; textarea.selectionend = caretpos; textarea.focus(); textarea.scrolltop = scrollpos; } // update the saved usercode every time the user updates the text area code textarea.onkeyup = function(){ // we only want to save the state when the user code is being shown, // not the solution, so that solution is not saved over the user code if(solution.value === 'show solution') { userentry = textarea.value; } else { solutionentry = textarea.value; } updatecode(); }; why do we need semantics?
...And 14 more matches
AddonManager
autoupdatedefault boolean whether add-ons should auto-update by default (overrideable per add-on).
... corresponds to the extensions.autoupdatedefault preference.
... state_checking an install that is checking for updated information.
...And 14 more matches
Border-image generator - CSS: Cascading Style Sheets
ect'; while (node.firstelementchild !== null) { option = node.firstelementchild; option_value = option.getattribute('data-value'); if (option_value === null) option.setattribute('data-value', uval); list.appendchild(node.firstelementchild); uval++; } node.appendchild(select); node.appendchild(list); select.onclick = this.toggle.bind(this); list.onclick = this.updatevalue.bind(this); document.addeventlistener('click', clickout); this.state = 0; this.time = 0; this.dropmenu = list; this.select = select; this.toggle(false); this.value = {}; this.topic = topic; if (label) select.textcontent = label; else this.setnodevalue(list.children[selected]); dropdowns[topic] = this; }; dropdown.prototype.toggle = function toggle(state) { ...
... if (active) active.toggle(false); active = this; } if (this.state === 0) this.dropmenu.setattribute('data-hidden', 'true'); else this.dropmenu.removeattribute('data-hidden'); }; var clickout = function clickout(e) { if (active.state === 0 || e.target === active.dropmenu || e.target === active.select) return; active.toggle(false); }; dropdown.prototype.updatevalue = function updatevalue(e) { if (date.now() - this.time < 500) return; if (e.target.classname !== "ui-dropdown-list") { this.setnodevalue(e.target); this.toggle(false); } this.time = date.now(); }; dropdown.prototype.setnodevalue = function setnodevalue(node) { this.value['name'] = node.textcontent; this.value['value'] = node.getattribute('data-value'); this.sele...
...nager.setvalue('slice-fill', prop['fill']); dropdownmanager.setvalue('image-repeat-x', prop['repeat'][0]); dropdownmanager.setvalue('image-repeat-y', prop['repeat'][1]); inputslidermanager.setvalue('preview-width', prop['size'][0]); inputslidermanager.setvalue('preview-height', prop['size'][1]); inputslidermanager.setvalue('preview-area-height', prop['preview_area']); }; var update = function update() { scale = math.min(300, (30000 / this.width) | 0); setscale(scale); inputslidermanager.setvalue('scale', scale, false); subject.style.backgroundimage = 'url("' + this.src + '")'; preview.style.borderimagesource = 'url("' + this.src + '")'; guidelines['slice-top'].setmax(this.height); guidelines['slice-right'].setmax(this.width); guidelines['slice-bot...
...And 14 more matches
HTTP caching - HTTP
WebHTTPCaching
cache-control: no-store cache but revalidate a cache will send the request to the origin server for validation before releasing a cached copy.
... cache-control: max-age=31536000 validation when using the "must-revalidate" directive, the cache must verify the status of the stale resources before using it and expired ones should not be used.
... cache-control: must-revalidate the pragma header pragma is a http/1.0 header, it is not specified for http responses and is therefore not a reliable replacement for the general http/1.1 cache-control header, although it does behave the same as cache-control: no-cache, if the cache-control header field is omitted in a request.
...And 14 more matches
CustomizableUI.jsm
if consumers make a change to the placements in an area, customizableui will update the actual nodes in each area instance for them.
...this is often when the window has opened, but in the case of add-ons, could fire when the node has just been registered with customizableui after an add-on update or disable/enable sequence.
...ode(atoolbar, aexistingchildren); void registermenupanel(apanel); void unregisterarea(aareaid, adestroyplacements); void addwidgettoarea(awidgetid, aareaid, [optional] aposition); void removewidgetfromarea(awidgetid); void movewidgetwithinarea(awidgetid, aposition); void ensurewidgetplacedinwindow(awidgetid, awindow); void beginbatchupdate(); void endbatchupdate(aforcedirty); widgetgroupwrapper createwidget(awidgetspecification); void destroywidget(awidgetid); widgetgroupwrapper getwidget(awidgetid); array getunusedwidgets(awindow); array getwidgetidsinarea(aareaid); array getwidgetsinarea(aareaid); string getareatype(aareaid); domelement getcustomizet...
...And 13 more matches
OS.File for the main thread
promise<uint8array> read(in string path, [optional] in object options); promise<void> remove(in string path, [optional] in object options); promise<void> removeemptydir(in string path, [optional] in object options); promise<void> removedir(in string path, [optional] in object options); promise<void> setcurrentdirectory(in string path); promise<void> setdates(in string path, in date|number accessdate, in date|number modificationdate); promise<void> setpermissions(in string path, in object options ); promise<file.info> stat(in string path, [optional] in object options); promise<void> unixsymlink(in string targetpath, in string createpath); promise<void> writeatomic(in string path, in arrayview data, in object optio...
... file.close(); this example is from stackoverflow: os.file check last modified date before os.read os.file.openunique() creates and opens a file with a unique name.
... os.file.setdates() set the last access and modification date of the file.
...And 13 more matches
RTCIceTransportState - Web APIs
the transport state indicates which stage of the candidate gathering process is currently underway.
... values "new" the rtcicetransport is currently gathering local candidates, or is waiting for the remote device to begin to transmit the remote candidates, or both.
... in this state, checking of candidates to look for those which might be acceptable has not yet begun.
...And 13 more matches
Event reference
compositionupdate a character is added to a passage of text being composed.
... durationchange the duration attribute has been updated.
... timeupdate the time indicated by the currenttime attribute has been updated.
...And 13 more matches
Using the application cache - HTML: Hypertext Markup Language
the browser then checks to see if the cache manifest has been updated on the server.
... if the cache manifest has been updated, the browser downloads a new version of the manifest and the resources listed in the manifest.
... if the currently-cached copy of the manifest is up-to-date, the browser sends a noupdate event to the applicationcache object, and the update process is complete.
...And 13 more matches
Microsummary XML grammar reference - Archive of obsolete content
<update> (optional) specifies how frequently firefox should update the microsummaries.
...the <update> element the optional <update> element specifies how frequently firefox should update microsummaries generated by the generator.
... the element can be used to specify both an absolute update interval and a series of conditional intervals based on the content of the page being summarized.
...And 12 more matches
Client-side form validation - Learn web development
using built-in form validation one of the most significant features of html5 form controls is the ability to validate most user data without relying on javascript.
...update your html to add a pattern attribute like this: <form> <label for="choose">would you prefer a banana or a cherry?</label> <input id="choose" name="i_like" required pattern="[bb]anana|[cc]herry"> <button>submit</button> </form> input:invalid { border: 2px dashed red; } input:valid { border: 2px solid black; } this gives us the following update — try it out: note: you can fin...
... note: some <input> element types don't need a pattern attribute to be validated against a regular expression.
...And 12 more matches
Making decisions in your code — conditionals - Learn web development
for example, we could update our weather forecast application to show a further set of choices depending on what the temperature is: if (choice === 'sunny') { if (temperature < 86) { para.textcontent = 'it is ' + temperature + ' degrees outside — nice and sunny.
... <label for="theme">select theme: </label> <select id="theme"> <option value="white">white</option> <option value="black">black</option> </select> <h1>this is my website</h1> const select = document.queryselector('select'); const html = document.queryselector('html'); document.body.style.padding = '10px'; function update(bgcolor, textcolor) { html.style.backgroundcolor = bgcolor; html.style.color = textcolor; } select.onchange = function() { ( select.value === 'black' ) ?
... update('black','white') : update('white','black'); } here we've got a <select> element to choose a theme (black or white), plus a simple <h1> to display a website title.
...And 12 more matches
Introduction to automated testing - Learn web development
in this article, we look at what is available, how to use task runners, and how to use the basics of commercial browser test automation apps such as lambdatest, sauce labs, browserstack, and testingbot.
...commercial cross-browser testing apps like lambdatest, sauce labs, browserstack, and testingbot are based on selenium, but allow you to access their set up remotely using a simple interface, saving you the hassle of setting up your own testing system.
...it is possible to set up a task runner to access a service like sauce labs, or lambdatest via an api, run cross browser tests, and return results.
...And 12 more matches
Creating localizable web applications
cheatsheet don't hardcode english text, formats (numbers, dates, addresses, etc.), word order or sentence structure.
... text messages don't hardcode english content allow localizers to localize english content, such as: text messages, number formats, date formats, word order and sentence structure.
... localize the date format localizing the date format is as easy as localizing any other string.
...And 12 more matches
<tr>: The Table Row element - HTML: Hypertext Markup Language
WebHTMLElementtr
<table> <tr> <th>name</th> <th>id</th> <th>member since</th> <th>balance</th> </tr> <tr> <td>margaret nguyen</td> <td>427311</td> <td><time datetime="2010-06-03">june 3, 2010</time></td> <td>0.00</td> </tr> <tr> <td>edvard galinski</td> <td>533175</td> <td><time datetime="2011-01-13">january 13, 2011</time></td> <td>37.00</td> </tr> <tr> <td>hoshi nakamura</td> <td>601942</td> <td><time datetime="2012-07-23">july 23, 2012</time></td> <td>15.00</td> </tr> </table> css this simple css just add...
... table { border: 1px solid black; } th, td { border: 1px solid black; } result row and column spanning now, let's introduce another column that shows the date the user's membership ended, along with a super-heading above the "joined" and "canceled" dates called "membership dates".
... result let's actually look at the output first this time: notice how the heading area here is actually two rows, one with "name", "id", "membership dates", and "balance" headings, and the other with "joined" and "canceled", which are sub-headings below "membership dates".
...And 12 more matches
Inner-browsing extending the browser navigation paradigm - Archive of obsolete content
the first one looks like a traditional dhtml ticker application and uses hidden iframes and javascript to provide updates inside the webpage's ticker headlines section.
...in this model, when a request goes to the web server, the current page is updated rather than replaced.
...good candidates for inner-browsing include a spell check application, in which the text entered in a web page is checked as it is typed; a webmail application that uses the inner-browsing model to display the separate messages and message lists in an integrated way, much like a client mail app; and a stock ticker that spools the information across the web page.
...And 11 more matches
Using XPInstall to Install Plugins - Archive of obsolete content
for those familiar with netscape communicator 4.x's smartupdate technology, this will be a familiar idea.
... a brief history of netscape installer technologies this section is relevant if you are familiar with netscape communicator 4.x's smartupdate installer technology.
...netscape communicator 4.x uses the notion of smartupdate to install software, particularly plugins and java applets to be run locally.
...And 11 more matches
calICalendarView - Archive of obsolete content
for instance, when the showdate method of the the calendar-multiday-view (an implementation of this interface) will sometimes show an entire week of dates, and sometimes show only the single date passed in.
... interface code [scriptable, uuid(3e567ccb-2ecf-4f59-b7ca-bf42b0fbf24a)] interface calicalendarview : nsisupports { attribute calicalendar displaycalender; attribute calicalendarviewcontroller controller; void showdate(in calidatetime adate); void setdaterange(in calidatetime astartdate, in calidatetime aenddate); readonly attribute calidatetime startdate; readonly attribute calidatetime enddate; readonly attribute boolean supportsdisjointdates; readonly attribute boolean hasdisjointdates; void setdatelist(in unsigned long acount, [array,size_is(acount)] in calidatetime adates); void getdatelist...
...(out unsigned long acount, [array,size_is(acount),retval] out calidatetime adates); attribute caliitembase selecteditem; attribute calidatetime selectedday; attributes displaycalendar the displaycalendar is an implementation of the calicalendar interface.
...And 11 more matches
The HTML5 input types - Learn web development
by default, the number input type only validates if the number is an integer.
... to actually display the current value, and update it as it changed, you must use javascript, but this is relatively easy to do: const price = document.queryselector('#price'); const output = document.queryselector('.price-output'); output.textcontent = price.value; price.addeventlistener('input', function() { output.textcontent = price.value; }); here we store references to the range input and the output in two variables.
...finally, an event listener is set to ensure that whenever the range slider is moved, the output's textcontent is updated to the new value.
...And 11 more matches
Fetching data from the server - Learn web development
previous overview: client-side web apis next another very common task in modern websites and applications is retrieving individual data items from the server to update sections of a webpage without having to load an entire new page.
... prerequisites: javascript basics (see first steps, building blocks, javascript objects), the basics of client-side apis objective: to learn how to fetch data from the server and use it to update the contents of a web page.
... the trouble with this model is that whenever you want to update any part of the page, for example, to display a new set of products or load a new page, you've got to load the entire page again.
...And 11 more matches
Mozilla Development Strategies
warning: the content of this article may be out of date.
... it has not been updated for usage of mercurial (instead of cvs).
... make sure documentation gets updated if the bug you're fixing is likely to require an update to developer documentation once it's fixed, be sure to add the dev-doc-needed keyword to the bug (or ask someone to do it, if you don't have editbugs privileges on bugzilla).
...And 11 more matches
Enc Dec MAC Using Key Wrap CertReq PKCS10 CSR
0s - certificate signing request \n\n", "-r <csr>"); fprintf(stderr, "%-30s - generate a self-signed cert [optional]\n\n", "-x"); fprintf(stderr, "%-30s - to enable ascii [optional]\n\n", "-a"); fprintf(stderr, "%-30s - to save certificate to header file as sig verification [optional]\n\n", "-v"); exit(-1); } /* * validate the options used for generate csr command */ static void validategeneratecsrcommand(const char *progname, const char *dbdir, certname *subject, const char *subjectstr, const char *certreqfilename) { prbool validationfailed = pr_false; if (!subject) { pr_fprintf...
...reqfilename) { pr_fprintf(pr_stderr, "%s -g -d %s -s %s -r: certificate request file name not found\n", progname, dbdir, subjectstr); validationfailed = pr_true; } if (validationfailed) { fprintf(stderr, "\nusage: %s %s \n\n", progname, "-g -d <dbdirpath> -s <subject> -r <csr> \n"); exit(-1); } } /* * validate the options used for add cert to db command */ static void validateaddcerttodbcommand(const char *progname, const char *dbdir, const char *nicknamestr, const char *truststr, const char *certfilename, const char *certreqfilename, ...
...intf(stderr, "\nusage: %s %s \n\n", progname, " -a -d <dbdirpath> -n <nickname> -t <trust> -c <cert> \n"); fprintf(stderr, " or\n"); fprintf(stderr, "\nusage: %s %s \n\n", progname, "-a -d <dbdirpath> -n <nickname> -t <trust> -c <cert> -r <csr> -u <issuernickname> -m <serialnumber> [-x <\"\">] \n"); exit(-1); } } /* * validate the options used for save cert to header command */ static void validatesavecerttoheadercommand(const char *progname, const char *dbdir, const char *nicknamestr, const char *headerfilename) { prbool validationfailed = pr_false; if (!nicknamestr) { pr_fprintf(pr_stderr, "%s -s...
...And 11 more matches
sample2
- certificate issuer nickname\n\n", "-u <issuernickname>"); fprintf(stderr, "%-30s - certificate signing request \n\n", "-r <csr>"); fprintf(stderr, "%-30s - generate a self-signed cert [optional]\n\n", "-x"); fprintf(stderr, "%-30s - to enable ascii [optional]\n\n", "-a"); fprintf(stderr, "%-30s - to save certificate to header file as sig verification [optional]\n\n", "-v"); exit(-1); } /* * validate the options used for generate csr command */ static void validategeneratecsrcommand(const char *progname, const char *dbdir, certname *subject, const char *subjectstr, const char *certreqfilename) { prbool validationfailed = pr_false; if (!subject) { pr_fprintf(pr_stderr, "%s -g -d %s -s: improperly formatted name: \"%s\"\n", progname, dbdir, subjectstr); validationfailed = pr_true; } if (!certre...
...qfilename) { pr_fprintf(pr_stderr, "%s -g -d %s -s %s -r: certificate request file name not found\n", progname, dbdir, subjectstr); validationfailed = pr_true; } if (validationfailed) { fprintf(stderr, "\nusage: %s %s \n\n", progname, "-g -d <dbdirpath> -s <subject> -r <csr> \n"); exit(-1); } } /* * validate the options used for add cert to db command */ static void validateaddcerttodbcommand(const char *progname, const char *dbdir, const char *nicknamestr, const char *truststr, const char *certfilename, const char *certreqfilename, const char *issuernamestr, const char *serialnumberstr, prbool selfsign) { prbool validationfailed = pr_false; if (!nicknamestr) { pr_fprintf(pr_stderr, "%s -a -d %s -n : nick name is missing\n", progname, dbdir); validationfailed = pr_true; } if (!truststr) { pr_f...
... issuernamestr); validationfailed = pr_true; } } if (validationfailed) { fprintf(stderr, "\nusage: %s %s \n\n", progname, " -a -d <dbdirpath> -n <nickname> -t <trust> -c <cert> \n"); fprintf(stderr, " or\n"); fprintf(stderr, "\nusage: %s %s \n\n", progname, "-a -d <dbdirpath> -n <nickname> -t <trust> -c <cert> -r <csr> -u <issuernickname> -m <serialnumber> [-x <\"\">] \n"); exit(-1); } } /* * validate the options used for save cert to header command */ static void validatesavecerttoheadercommand(const char *progname, const char *dbdir, const char *nicknamestr, const char *headerfilename) { prbool validationfailed = pr_false; if (!nicknamestr) { pr_fprintf(pr_stderr, "%s -s -d %s -n : nick name is missing\n", progname, dbdir); validationfailed = pr_true; } if (!headerfilename) { pr_fprintf(pr_s...
...And 11 more matches
nsIDOMWindowUtils
olean dispatchdomeventviapresshell(in nsidomnode atarget, in nsidomevent aevent, in boolean atrusted); nsidomelement elementfrompoint(in float ax, in float ay, in boolean aignorerootscrollframe, in boolean aflushlayout); void entermodalstate(); nsidomelement findelementwithviewid(in nsviewid aid); void focus(in nsidomelement aelement); void forceupdatenativemenuat(in astring indexstring); void garbagecollect([optional] in nsicyclecollectorlistener alistener); short getcursortype(); astring getdocumentmetadata(in astring aname); nsidomwindow getouterwindowwithid(in unsigned long long aouterwindowid); long getpccountscriptcount(); astring getpccountscriptsummary(in long ascript); ...
..., in astring apropertyname); boolean isinmodalstate(); void leavemodalstate(); void loadsheet(in nsiuri sheeturi, in unsigned long type); nsidomnodelist nodesfromrect(in float ax, in float ay, in float atopsize, in float arightsize, in float abottomsize, in float aleftsize, in boolean aignorerootscrollframe, in boolean aflushlayout); void processupdates(); obsolete since gecko 13.0 void purgepccounts(); unsigned long redraw([optional] in unsigned long acount); void renderdocument(in nsconstrect arect, in pruint32 aflags, in nscolor abackgroundcolor, in gfxcontext athebescontext); native code only!
... forceupdatenativemenuat() see nsiwidget.forceupdatenativemenuat().
...And 11 more matches
JavaScript Daemons Management - Archive of obsolete content
verse, bforce); }; daemon.prototype.reclose = function (bforce) { /* warning: this method requires the daemon.prototype.makesteps() and daemon.prototype.close() methods */ return this.close(this.isatend() !== this.backw, bforce || false); }; /* others */ daemon.prototype.restart = function () { this.stop(); this.start(); }; daemon.prototype.loopuntil = function (vdate) { if (!isfinite(this.length)) { return; } var ntime = vdate.constructor === date ?
... vdate.gettime() : isnan(vdate) ?
... date.parse(vdate) : vdate; if (isfinite(ntime) && ntime > date.now()) { this.reversals = math.floor((ntime - date.now() - (this.backw ?
...And 10 more matches
Introduction to Public-Key Cryptography - Archive of obsolete content
nonrepudiation prevents the sender of information from claiming at a later date that the information was never sent.
...certificate authorities (cas) are entities that validate identities and issue certificates.
...the methods used to validate an identity vary depending on the policies of a given ca-just as the methods to validate other forms of identification vary depending on who is issuing the id and the purpose for which it will be used.
...And 10 more matches
Getting started with HTML - Learn web development
see your changes update live in the output area.
...a11y-label { margin: 0; text-align: right; font-size: 0.7rem; width: 98%; } body { margin: 10px; background: #f5f9fa; } var textarea = document.getelementbyid('code'); var reset = document.getelementbyid('reset'); var solution = document.getelementbyid('solution'); var output = document.queryselector('.output'); var code = textarea.value; var userentry = textarea.value; function updatecode() { output.innerhtml = textarea.value; } reset.addeventlistener('click', function() { textarea.value = code; userentry = textarea.value; solutionentry = htmlsolution; solution.value = 'show solution'; updatecode(); }); solution.addeventlistener('click', function() { if(solution.value === 'show solution') { textarea.value = solutionentry; solution.value = 'hide solution...
...'; } else { textarea.value = userentry; solution.value = 'show solution'; } updatecode(); }); var htmlsolution = '<em>this is my text.</em>'; var solutionentry = htmlsolution; textarea.addeventlistener('input', updatecode); window.addeventlistener('load', updatecode); // stop tab key tabbing out of textarea and // make it write a tab at the caret position instead textarea.onkeydown = function(e){ if (e.keycode === 9) { e.preventdefault(); insertatcaret('\t'); } if (e.keycode === 27) { textarea.blur(); } }; function insertatcaret(text) { var scrollpos = textarea.scrolltop; var caretpos = textarea.selectionstart; var front = (textarea.value).substring(0, caretpos); var back = (textarea.value).substring(textarea.selectionend, textarea.value.length)...
...And 10 more matches
Useful string methods - Learn web development
to actually update the value of the browsertype variable in a real program, you'd have to set the variable value to be the result of the operation; it doesn't just update the substring value automatically.
...sans-serif; } h2 { font-size: 16px; } .a11y-label { margin: 0; text-align: right; font-size: 0.7rem; width: 98%; } body { margin: 10px; background: #f5f9fa; } const textarea = document.getelementbyid('code'); const reset = document.getelementbyid('reset'); const solution = document.getelementbyid('solution'); let code = textarea.value; let userentry = textarea.value; function updatecode() { eval(textarea.value); } reset.addeventlistener('click', function() { textarea.value = code; userentry = textarea.value; solutionentry = jssolution; solution.value = 'show solution'; updatecode(); }); solution.addeventlistener('click', function() { if(solution.value === 'show solution') { textarea.value = solutionentry; solution.value = 'hide solution'; } else { ...
... textarea.value = userentry; solution.value = 'show solution'; } updatecode(); }); const jssolution = 'const list = document.queryselector(\'.output ul\');' + '\nlist.innerhtml = \'\';' + '\nlet greetings = [\'happy birthday!\',' + '\n \'merry christmas my love\',' + '\n \'a happy christmas to all the family\',' + '\n \'you\\\'re all i want for christmas\',' + '\n \'get well soon\'];' + '\n' + '\nfor (let i = 0; i < greetings.length; i++) {' + '\n let input = greetings[i];' + '\n if (greetings[i].indexof(\'christmas\') !== -1) {' + '\n let result = input;' + '\n let listitem = document.createelement(\'li\');' + '\n listitem.textcontent = result;' + '\n list.appendchild(listitem);' + '\n }' + '\n}'; let s...
...And 10 more matches
nsINavBookmarkObserver
1.0 66 introduced gecko 1.8 inherits from: nsisupports last changed in gecko 21.0 (firefox 21.0 / thunderbird 21.0 / seamonkey 2.18) method overview void onbeforeitemremoved(in long long aitemid, in unsigned short aitemtype, in long long aparentid, in acstring aguid, in acstring aparentguid); obsolete since gecko 21.0 void onbeginupdatebatch(); void onendupdatebatch(); void onfolderadded(in print64 folder, in print64 parent, in print32 index); obsolete since gecko 1.9 void onfolderchanged(in print64 folder, in acstring property); obsolete since gecko 1.9 void onfoldermoved(in print64 folder, in print64 oldparent, in print32 oldindex, in print64 newparent, in print32 newindex); obsolete since g...
...ecko 1.9 void onfolderremoved(in print64 folder, in print64 parent, in print32 index); obsolete since gecko 1.9 void onitemadded(in long long aitemid, in long long aparentid, in long aindex, in unsigned short aitemtype, in nsiuri auri, in autf8string atitle, in prtime adateadded, in acstring aguid, in acstring aparentguid); void onitemchanged(in long long aitemid, in acstring aproperty, in boolean aisannotationproperty, in autf8string anewvalue, in prtime alastmodified, in unsigned short aitemtype, in long long aparentid, in acstring aguid, in acstring aparentguid); void onitemmoved(in long long aitemid, in long long aoldparentid, in long aoldindex, in long long anewparentid, in long anewindex, in unsigned short aitemtype, in acstring aguid, in acstring aold...
... onbeginupdatebatch() this method notifies this observer that a batch transaction has started.
...And 10 more matches
nsINavHistoryResultObserver
toolkit/components/places/nsinavhistoryservice.idlscriptable lets clients observe changes to a result as the result updates itself according to bookmark and history system events.
...ntainerclosed(in nsinavhistorycontainerresultnode acontainernode); deprecated since gecko 2.0 obsolete since gecko 11.0 void containeropened(in nsinavhistorycontainerresultnode acontainernode); deprecated since gecko 2.0 obsolete since gecko 11.0 void containerstatechanged(in nsinavhistorycontainerresultnode acontainernode, in unsigned long aoldstate, in unsigned long anewstate); void invalidatecontainer(in nsinavhistorycontainerresultnode acontainernode); void nodeannotationchanged(in nsinavhistoryresultnode anode, in autf8string aannoname); void nodedateaddedchanged(in nsinavhistoryresultnode anode, in prtime anewvalue); void nodehistorydetailschanged(in nsinavhistoryresultnode anode, in prtime anewvisitdate, in unsigned long anewaccesscount); void nodeiconchanged(in nsinavhist...
...the observer can then pause updates or events until the batch is completed, so that it won't handle the large number of updates that are about to be notified.
...And 10 more matches
Timing element visibility with the Intersection Observer API - Web APIs
function handlevisibilitychange() { if (document.hidden) { if (!previouslyvisibleads) { previouslyvisibleads = visibleads; visibleads = []; previouslyvisibleads.foreach(function(adbox) { updateadtimer(adbox); adbox.dataset.lastviewstarted = 0; }); } } else { previouslyvisibleads.foreach(function(adbox) { adbox.dataset.lastviewstarted = performance.now(); }); visibleads = previouslyvisibleads; previouslyvisibleads = null; } } since the event itself doesn't state whether the document has switched from visible to invisible or vice-versa, the doc...
...then, for each of the ads that are being suspended, we call our updateadtimer() function, which handles updating the ad's total visible time counter, then we set their dataset.lastviewstarted property to 0, which indicates that the tab's timer isn't running.
...now the ads are all restarted, and configured to know that they became visible at the current time, so that they will not add up the duration of time the page was tabbed away the next time they're updated.
...And 10 more matches
RTCIceTransport - Web APIs
role read only returns a domstring whose value is one of the members of the rtcicerole enumerated type: "controlling" or "controlled"; this indicates whether the ice agent is the one that makes the final decision as to the candidate pair to use or not.
...the value of state can be used to determine whether the ice agent has made an initial connection using a viable candidate pair ("connected"), made its final selection of candidate pairs ("completed"), or in an error state ("failed"), among other states.
... getlocalcandidates() returns an array of rtcicecandidate objects, each describing one of the ice candidates that have been gathered so far for the local device.
...And 10 more matches
Request.cache - Web APIs
WebAPIRequestcache
otherwise the resource will be downloaded from the server and the cache will be updated.
... if there is no match, the browser will make a normal request, and will update the cache with the downloaded resource.
... no-store — the browser fetches the resource from the remote server without first looking in the cache, and will not update the cache with the downloaded resource.
...And 10 more matches
Using CSS transitions - CSS: Cascading Style Sheets
-transition-property: width height background-color font-size left top transform -webkit-transform color; -webkit-transition-duration: 0.5s; -webkit-transition-timing-function: ease-in-out; transition-property: width height background-color font-size left top transform -webkit-transformv color; transition-duration: 0.5s; transition-timing-function: ease-in-out; } function updatetransition() { var el = document.queryselector("div.box"); if (el) { el.classname = "box1"; } else { el = document.queryselector("div.box1"); el.classname = "box"; } return el; } var intervalid = window.setinterval(updatetransition, 7000); transition-duration: 1s <div class="parent"> <div class="box">lorem</div> </div> .parent { width: 250px; height...
...ebkit-transition-property: width height background-color font-size left top -webkit-transform transform color; -webkit-transition-duration: 1s; -webkit-transition-timing-function: ease-in-out; transition-property: width height background-color font-size left top transform -webkit-transform color; transition-duration: 1s; transition-timing-function: ease-in-out; } function updatetransition() { var el = document.queryselector("div.box"); if (el) { el.classname = "box1"; } else { el = document.queryselector("div.box1"); el.classname = "box"; } return el; } var intervalid = window.setinterval(updatetransition, 7000); transition-duration: 2s <div class="parent"> <div class="box">lorem</div> </div> .parent { width: 250px; height...
...ebkit-transition-property: width height background-color font-size left top transform -webkit-transform color; -webkit-transition-duration: 2s; -webkit-transition-timing-function: ease-in-out; transition-property: width height background-color font-size left top transform -webkit-transform color; transition-duration: 2s; transition-timing-function: ease-in-out; } function updatetransition() { var el = document.queryselector("div.box"); if (el) { el.classname = "box1"; } else { el = document.queryselector("div.box1"); el.classname = "box"; } return el; } var intervalid = window.setinterval(updatetransition, 7000); transition-duration: 4s <div class="parent"> <div class="box">lorem</div> </div> .parent { width: 250px; height...
...And 10 more matches
HTTP conditional requests - HTTP
such requests can be useful to validate the content of a cache, and sparing a useless control, to verify the integrity of a document, like when resuming a download, or when preventing to lose updates when uploading or modifying a document on the server.
...such values are called validators, and are of two kinds: the date of last modification of the document, the last-modified date.
...this is even if they are minor differences; like different ads, or a footer with a different date.
...And 10 more matches
HTTP Index - HTTP
WebHTTPIndex
rudp — the reliable update of udp — is a suitable alternative.
... 7 evolution of http guide, http, needsupdate, needsupdate(http/3) http (hypertext transfer protocol) is the underlying protocol of the world wide web.
...such requests can be useful to validate the content of a cache, and sparing a useless control, to verify the integrity of a document, like when resuming a download, or when preventing to lose updates when uploading or modifying a document on the server.
...And 10 more matches
jpm - Archive of obsolete content
supporting updates for self-hosted add-ons this feature is only supported from jpm 1.0.3 onwards.
... when you make updates to your add-on to add features or fix bugs, you'll want any previously installed versions of the add-on to update themselves to the new version.
...the way this works is: you run jpm sign anytime you need to create a new version you host the signed add-on xpi and update it when you need to you host an "update manifest", which, among other things, contains a url pointing to the xpi your add-on tells firefox where it can find the update manifest to do this, include two extra keys in package.json: updateurl: this url is included in the install manifest of the xpi file that jpm xpi builds.
...And 9 more matches
Adding a new todo form: Vue events, methods, and models - Learn web development
however, we can't update our list of items without manually changing our code!
...update your template as follows: <template> <form> <label for="new-todo-input"> what needs to be done?
...go back to app.vue and add the following import statement just below the previous one, inside your <script> element: import todoform from './components/todoform'; you also need to register the new component in your app component — update the components property of the component object so that it looks like this: components: { todoitem, todoform } finally for this section, render your todoform component inside your app by adding the <to-do-form /> element inside your app's <template>, like so: <template> <div id="app"> <h1>my to-do list</h1> <to-do-form></to-do-form> <ul> <li v-for="item in todo...
...And 9 more matches
nsIDOMOfflineResourceList
last changed in gecko 1.9.2 (firefox 3.6 / thunderbird 3.1 / fennec 1.0) inherits from: nsisupports method overview void mozadd(in domstring uri); boolean mozhasitem(in domstring uri); domstring mozitem(in unsigned long index); void mozremove(in domstring uri); void swapcache(); void update(); attributes attribute type description mozitems nsidomofflineresourcelist the list of dynamically-managed entries in the offline resource list.
... onchecking nsidomeventlistener an event listener to be called when fetching the application cache manifest and checking for updates.
... onnoupdate nsidomeventlistener an event listener to be called when there is no update to download.
...And 9 more matches
nsINavHistoryResultViewer
method overview void containerclosed(in nsinavhistorycontainerresultnode acontainernode); void containeropened(in nsinavhistorycontainerresultnode acontainernode); void invalidatecontainer(in nsinavhistorycontainerresultnode acontainernode); void nodeannotationchanged(in nsinavhistoryresultnode anode, in autf8string aannoname); void nodedateaddedchanged(in nsinavhistoryresultnode anode, in prtime anewvalue); void nodelastaddedchanged(in nsinavhistoryresultnode anode, in prtime anewvalue); void nodehistorydetailschanged(in nsinavhistor...
...yresultnode anode, in prtime anewvisitdate, in unsigned long anewaccesscount); void nodeiconchanged(in nsinavhistoryresultnode anode); void nodekeywordchanged(in nsinavhistoryresultnode anode, in autf8string anewkeyword); void nodemoved(in nsinavhistoryresultnode anode, in nsinavhistorycontainerresultnode aoldparent, in unsigned long aoldindex, in nsinavhistorycontainerresultnode anewparent, in unsigned long anewindex); void nodetitlechanged(in nsinavhistoryresultnode anode, in autf8string anewtitle); void noderemoved(in nsinavhistorycontainerresultnode aparent, in nsinavhistoryresultnode anode, in unsigned long aoldindex); void nodetagschanged(in nsinavhistoryresultnode anode); void nodeurichanged(in nsinavhistoryresultnode a...
... invalidatecontainer() called when something has happened that requires that the contents of a container be rebuilt.
...And 9 more matches
Web Console remoting - Firefox Developer Tools
actor preferences to allow the web console to configure logging options while it is running, we have added the setpreferences packet: { "to": "conn0.console9", "type": "setpreferences", "preferences": { "networkmonitor.saverequestandresponsebodies": false } } reply: { "updated": [ "networkmonitor.saverequestandresponsebodies" ], "from": "conn0.console10" } for convenience you can use webconsoleclient.setpreferences(prefs, onresponse).
... ], }, } the response packet is a network event actor grip: { "to": "conn0.console9", "eventactor": { "actor": "conn0.netevent14", "starteddatetime": "2013-08-26t19:50:03.699z", "url": "http://localhost", "method": "get" "isxhr": true, "private": false } } you can also use the webconsoleclient.sendhttprequest(request, onresponse) method.
... the variable view needs to update objects and it does so by binding _self to the debugger.object of the objectactor that is being viewed.
...And 9 more matches
HTMLInputElement - Web APIs
formnovalidate boolean: returns / sets the element's formnovalidate attribute, indicating that the form is not to be validated when it is submitted.
... this overrides the novalidate attribute of the parent form.
...this is the empty string if the control is not a candidate for constraint validation (willvalidate is false), or it satisfies its constraints.
...And 9 more matches
Key Values - Web APIs
common ime keys keyboardevent.key value description virtual keycode windows mac linux android "allcandidates" the all candidates key, which starts multi-candidate mode, in which multiple candidates are displayed for the ongoing input.
... gdk_key_multiplecandidate (0xff3d qt::key_multiplecandidate (0x0100113d) "alphanumeric" the alphanumeric key.
... if you wish to identify which specific dead key was pressed (in cases where more than one exists), you can do so by examining the keyboardevent's associated compositionupdate event's data property.
...And 9 more matches
PaymentRequest.show() - Web APIs
if this is provided, show() will not allow the user to interact with the payment interface until the promise is fulfilled, so that data can be updated prior to the user engaging with the payment process.
...most examples on mdn and elsewhere use async/await to wait asynchronously while results are validated and so forth.
... syntax paymentpromise = paymentrequest.show(detailspromise); parameters detailspromise optional an optional promise that you can provide if your architecture requires that the payment request's details need to be updated between instantiating the payment interface and the user beginning to interact with it.
...And 9 more matches
RTCIceTransport.state - Web APIs
its value will be one of the following: "new" the rtcicetransport is currently gathering local candidates, or is waiting for the remote device to begin to transmit the remote candidates, or both.
... in this state, checking of candidates to look for those which might be acceptable has not yet begun.
... "checking" at least one remote candidate has been received, and the rtcicetransport has begun examining pairings of remote and local candidates in order to attempt to identify viable pairs that could be used to establish a connection.
...And 9 more matches
widget - Archive of obsolete content
widgets.widget({ id: "mouseover-effect", label: "widget with changing image on mouseover", contenturl: "http://www.yahoo.com/favicon.ico", onmouseover: function() { this.contenturl = "http://www.bing.com/favicon.ico"; }, onmouseout: function() { this.contenturl = "http://www.yahoo.com/favicon.ico"; } }); // a widget that updates content on a timer.
... widgets.widget({ id: "auto-update-widget", label: "widget that updates content on a timer", content: "0", contentscript: 'settimeout(function() {' + ' document.body.innerhtml++;' + '}, 2000)', contentscriptwhen: "ready" }); // a widget created with a specified width, that grows.
...setting it updates the widget's appearance immediately.
...And 8 more matches
places/bookmarks - Archive of obsolete content
usage this module exports: three constructors: bookmark, group, and separator, corresponding to the types of objects, referred to as bookmark items, in the bookmarks database in firefox two additional functions, save() to create, update, and remove bookmark items, and search() to retrieve the bookmark items that match a particular set of criteria.
...k, save } = require("sdk/places/bookmarks"); // create a new bookmark instance, unsaved let bookmark = bookmark({ title: "mozilla", url: "http://mozilla.org" }); // attempt to save the bookmark instance to the bookmarks database // and store the emitter let emitter = save(bookmark); // listen for events emitter.on("data", function (saved, inputitem) { // on a "data" event, an item has been updated, passing in the // latest snapshot from the server as `saved` (with properties // such as `updated` and `id`), as well as the initial input // item as `inputitem` console.log(saved.title === inputitem.title); // true console.log(saved !== inputitem); // true console.log(inputitem === bookmark); // true }).on("end", function (saveditems, inputitems) { // similar to "data" events, ex...
... save(bookmarks).on("data", function (saved, input) { // a data event is called once for each item saved, as well // as implicit items, like `group` console.log(input === group || ~bookmarks.indexof(input)); // true }).on("end", function (saves, inputs) { // like the previous example, the "end" event returns an // array of all of our updated saves.
...And 8 more matches
MCD, Mission Control Desktop, AKA AutoConfig - Archive of obsolete content
also related post in newsgroups: mozilla.dev.tech.js-engine date: wed, 17 may 2006 19:06:28 +0200 from: jehan procaccia <jehan.procaccia@int-evry.fr> newsgroups: mozilla.dev.tech.js-engine subject: scope of js file functions in frefox/thunderbird autoconfig context firefox 2.x recently (2007/03/20), i've tested autoconfig support in firefox 2.0.0.2 on a linux fedora.
...that "bug" report is then still up to date!: bug 295329 $ cat /etc/redhat-release fedora core release 6 (zod) $ rpm -qi firefox name : firefox relocations: (not relocatable) version : 2.0.0.2 vendor: remi collet release : 1.fc6.remi build date: sat 24 feb 2007 01:45:37 pm cet install date: tue 20 mar 2007 02:47:27 pm cet build host: remi.famillecollet.com packager : http://remi.collet.free.fr/ references other documents about autoconfig http://mit.edu/~firefox/www/maintain...utoconfig.html http://www.alain.knaff.lu/howto/mozi...ion/index.html ht...
...rial.i586 0:1.2.1-1.fc11 check merge tools in [root@b008-02 ~]# vim /etc/mercurial/hgrc.d/mergetools.rc get the source comm-central [root@b008-02 moz]# time hg clone http://hg.mozilla.org/comm-central/ commsrc requesting all changes adding changesets adding manifests adding file changes added 2975 changesets with 16793 changes to 7117 files (+3 heads) updating working directory 5644 files updated, 0 files merged, 0 files removed, 0 files unresolved real 0m40.771s user 0m9.284s sys 0m1.304s [root@b008-02 commsrc]# python client.py checkout executing command: ['hg', 'pull', '-r', './.', '-r', 'tip'] pulling from http://hg.mozilla.org/comm-central/ searching for changes no changes found executing command: ['hg', 'update', '-r', 'default', '-r', './.'] 0 files updated, 0 files ...
...And 8 more matches
How to Write and Land Nanojit Patches - Archive of obsolete content
[njn: it's possible that the other tm/tr public repo hasn't been updated from nanojit-central sufficiently recently, in which case the patch won't apply cleanly.
... if it's major you'll need to do a private update of that other repo in order to test.
... but don't push that update, as that should only be done by a member of that public repo.] once it passes testing, file the patch to bugzilla (file a bug under the "nanojit" component in the "core" product) and get a review.
...And 8 more matches
Numeric Controls - Archive of obsolete content
« previousnext » xul has two elements used for the entry of numeric values or ranges, and well as two elements for entering dates and times.
...date and time entry fields the datepicker and timepicker elements may be used to allow the user to enter dates and times.
... when used, they display a set of numeric textboxes to enter each of the components of the date or time.
...And 8 more matches
commandset - Archive of obsolete content
in addition, this element can hold a command updater which is used to update commands when certain events occur.
... a common use of the command updater is to update cut, copy, and paste menu items.
... attributes commandupdater, events, oncommandupdate, targets example <commandset> <command id="cmd_open" oncommand="alert('open!');"/> <command id="cmd_help" oncommand="alert('help!');"/> </commandset> attributes commandupdater type: boolean if true, the commandset is used for updating commands.
...And 8 more matches
Handling common accessibility problems - Learn web development
complex functionality one of the main areas problematic for accessibility is complex apps that involve complicated form controls (such as date pickers) and dynamic content that is updated often and incrementally.
... regularly updated dynamic content can be a problem because screenreader users might miss it, especially if it updates unexpectedly.
... if you have a single-page app with a main content panel that is regularly updated using xmlhttprequest or fetch, a screenreader user might miss those updates.
...And 8 more matches
Eclipse CDT
since it's a pain to install them and keep them up to date we do not recommend getting eclipse this way.) increase eclipse's memory limits!
... keeping the index up-to-date as the source changes from day-to-day, you'll want to update the index to keep the code assistance working well.
...in principle, you can set the index to rebuild automatically by opening the workspace preferences, selecting "c/c++ > indexer", and reenabling "automatically update the index".
...And 8 more matches
OS.File.Info
instances of os.file.info represent file metadata, such as the size of the file, its last modification date, etc.
... creationdate deprecated in bugzilla :: bug 807875.
... before deprecation, this used to be the date at which the file was created on windows and mac os x, as a javascript date object.
...And 8 more matches
NSS Tools crlutil
list of possible algorithms: md2 | md4 | md5 | sha1 | sha256 | sha384 | sha512 -n nickname specify the nickname of a certificate or key to list, create, add to a database, modify, or validate.
... crl generation script syntax: crl generation script file has the following syntax: line with comments should have <bold>#</bold> as a first symbol of a line set "this update" or "next update" crl fields: update=yyyymmddhhmmssz nextupdate=yyyymmddhhmmssz field "next update" is optional.
... add certificate entries(s) to crl: addcert range date where: range: two integer values separated by dash: range of certificates that will be added by this command.
...And 8 more matches
Index
7 gcintegration developing mozilla, firefox, garbage collection, intermediate, intro, jsapi, needsupdate, spidermonkey, tools, memory the spidermonkey garbage collector (gc) will be changing a lot in the future.
... 152 jsruntime jsapi reference, needscontent, needsupdate, spidermonkey in the jsapi, jsruntime is the top-level object that represents an instance of the javascript engine.
... 199 js_cleardatecaches date, jsapi reference, javascript, reference, référence(2), spidermonkey js_cleardatecaches clears the cache of calculated local time from each date object.
...And 8 more matches
Places Developer Guide
accessing bookmarks and related items accessing item properties for all items: string getitemtitle(aitemid) - returns an item's title int64 getitemindex(aitemid) - returns an item's position in it's parent folder prtime getitemtype(aitemid) - returns the type of an item (bookmark, folder, separator) prtime getitemdateadded(aitemid) - returns the time in microseconds that an item was added prtime getitemlastmodified(aitemid) - returns the time in microseconds that an item was last modified int64 getfolderidforitem(aitemid) - returns the id of the folder containing the given item.
... setitemdateadded(aitemid, adateadded) - set the date the item was first added, in microseconds.
... setitemlastmodified(aitemid, alastmodified) - set the date the item was last modified, in microseconds.
...And 8 more matches
nsICryptoHash
1.0 66 introduced gecko 1.8 inherits from: nsisupports last changed in gecko 1.8 (firefox 1.5 / thunderbird 1.5 / seamonkey 1.0) method overview acstring finish(in prbool aascii); void init(in unsigned long aalgorithm); void initwithstring(in acstring aalgorithm); void update([const, array, size_is(alen)] in octet adata, in unsigned long alen); void updatefromstream(in nsiinputstream astream, in unsigned long alen); constants hash algorithms these constants are used by the init() method to indicate which hashing function to use.
... exceptions thrown ns_error_invalid_arg indicates that an unsupported algorithm type was passed update() adds an array of data to be hashed to the object.
... void update( [const, array, size_is(alen)] in octet adata, in unsigned long alen ); parameters adata a buffer to calculate the hash over.
...And 8 more matches
Border-radius generator - CSS: Cascading Style Sheets
is.unity = 0; this.unitr = 0; this.maxw = 100; this.maxh = 100; this.maxr = 100; this.topic = y + '-' + x; var sliderw = inputslidermanager.getnode(this.topic + '-w'); var sliderh = inputslidermanager.getnode(this.topic + '-h'); var sliderr = inputslidermanager.getnode(this.topic); this.setunitx(this.unitx); this.setunity(this.unity); this.setunitr(this.unitr); this.updatewidth(); this.updateheight(); this.updateradius(); if (x === 'left') this.resizex = 1; if (x === 'right') this.resizex = -1; if (y === 'top') this.resizey = 1; if (y === 'bottom') this.resizey = -1; radius.classname = 'radius'; var unit_selector = document.getelementbyid("unit-selection"); var unitw = new unitselector(this.topic + '-w'); var unith = new unitselector(this.t...
... === 'right' && y == 'top') handle.classname = 'handle handle-top-right'; if (x === 'right' && y == 'bottom') handle.classname = 'handle handle-bottom-right'; if (x === 'left' && y == 'bottom') handle.classname = 'handle handle-bottom-left'; handle.addeventlistener("mousedown", function(e) { active = true; this.radius.style.display = 'block'; previewmousetracking.subscribe(this.updatecontainer.bind(this)); }.bind(this)); document.addeventlistener("mouseup", function(e) { this.radius.style.display = 'none'; if (active === true) previewmousetracking.unsubscribe(this.updatecontainer.bind(this)); }.bind(this)); inputslidermanager.subscribe(this.topic + '-w', this.setwidth.bind(this)); inputslidermanager.subscribe(this.topic + '-h', this.setheight.bind(this));...
...(this)); buttonmanager.subscribe(this.topic, function(value) { this.rounded = value; if (value === true) { unitw.container.style.display = 'none'; unith.container.style.display = 'none'; unitr.container.style.display = 'block'; sliderw.style.display = 'none'; sliderh.style.display = 'none'; sliderr.style.display = 'block'; this.setunitr(this.unitr); this.updateradius(); } if (value === false) { unitw.container.style.display = 'block'; unith.container.style.display = 'block'; unitr.container.style.display = 'none'; sliderw.style.display = 'block'; sliderh.style.display = 'block'; sliderr.style.display = 'none'; this.setunitx(this.unitx); this.setunity(this.unity); this.updatewidth(); this.updateheight(); ...
...And 8 more matches
Microformats - HTML: Hypertext Markup Language
microformats2 is an update to microformats that provides a simpler way of annotating html structured syntax & vocabularies than previous approaches of using rdfa and microdata which require learning new attributes.
...for example: h-card describes a person or organization h-entry describes episodic or date stamped online content like a blog post h-feed describes a stream or feed of posts you can find many more vocabularies on the microformats2 wiki.
... "dt-*" for datetime properties, e.g.
...And 8 more matches
SVG documentation index - SVG: Scalable Vector Graphics
WebSVGIndex
16 svg event attributes advanced, attribute, draft, landing, needsupdate, svg event attributes always have their name starting with "on" followed by the name of the event for which they are intended.
... 270 svg tutorial intermediate, needscontent, needshelp, needsupdate, svg, svg:tutorial scalable vector graphics, svg, is a w3c xml dialect to mark up graphics.
... 276 getting started beginner, needsbeginnerupdate, svg, svg:tutorial let us dive straight in with a simple example.
...And 8 more matches
ui/button/toggle - Archive of obsolete content
this can contain a number or a string, and you can update it at any time.
...a disabled button will not generate click or change events and its icon will appear disabled: updating state you can update all the button's properties, except for its id.
...to set state like this, call state() with 2 parameters: the first parameter is a window or tab object or as a shorthand, the string "window" for the currently active window, or the string "tab" for the currently active tab the second parameter is an object containing the state properties you wish to update.
...And 7 more matches
cfx - Archive of obsolete content
updateurl and updatelink if you choose to host the xpi yourself you should enable the host application to find new versions of your add-on.
... to do this, include a url in the xpi called the updateurl: the host application will go here to get information about updates.
... at the updateurl you host a file in the update rdf format: among other things, this includes another url called updatelink which points to the updated xpi itself.
...And 7 more matches
How to convert an overlay extension to restartless - Archive of obsolete content
as of may 29, 2017, that module does not work with packed extensions; i'm preserving the link in case the author updates the gist to fix this issue).
...doing anuncompressed internal jar (aka, another zip) acts like a poor-man's solid archive and significantly boosts the overall compression ratio of the xpi, resulting in smaller installers and updates.
...your restartless add-on won't actually reload some types of files if they are in a jar and the add-on is updated without a restart.
...And 7 more matches
Monitoring downloads - Archive of obsolete content
the download manager instance is cached into a member variable in the downloadlogger object for reuse later, and its addlistener() method is called to start listening for download status updates.
... if the download's state indicates that the download is finished, canceled, or failed, we call our logtransfercompleted routine to update the log to indicate that state change.
... that code looks like this: logtransfercompleted: function(adownload) { var endtime = new date(); // current time is the end time // issue the replace sqlite command to update the record.
...And 7 more matches
Back to the Server: Server-Side JavaScript On The Rise - Archive of obsolete content
fault xml namespace = "http://purl.org/rss/1.0/"; var dc = new namespace( "http://purl.org/dc/elements/1.1/" ); var rdf = new namespace( "http://www.w3.org/1999/02/22-rdf-syntax-ns#" ); // use e4x to process the feed var x = new xml( str ); for each( var i in x..item ) { print( "title: " + i.title + "\n" ); print( "about: " + i.@rdf::about + "\n" ); print( "link: " + i.link + "\n" ); print( "date: " + i.dc::date + "\n" ); } the first half of this script is standard java code used to retrieve the feed data.
...notice during the processing of the item element where we use the rdf and dc namespace to access the about attribute of the item element, and the date element respectively.
...see listing 5 for an update to listing 1 to reflect this.
...And 7 more matches
Desktop gamepad controls - Game development
to update the state of the gamepad's currently pressed buttons we will need a function that will do exactly that on every frame: function gamepadupdatehandler() { buttonspressed = []; if(controller.buttons) { for(var b=0; b<controller.buttons.length; b++) { if(controller.buttons[b].pressed) { buttonspressed.push(b); } } } } we first rese...
... next, in the draw() function we do two things — execute the gamepadupdatehandler() function to get the current state of pressed buttons on every frame, and use the gamepadbuttonpressedhandler() function to check the buttons we are interested to see whether they are pressed, and do something if they are: function draw() { ctx.clearrect(0, 0, canvas.width, canvas.height); // ...
... gamepadupdatehandler(); if(gamepadbuttonpressedhandler(0)) { playery -= 5; } else if(gamepadbuttonpressedhandler(1)) { playery += 5; } if(gamepadbuttonpressedhandler(2)) { playerx -= 5; } else if(gamepadbuttonpressedhandler(3)) { playerx += 5; } if(gamepadbuttonpressedhandler(11)) { alert('boom!'); } // ...
...And 7 more matches
Index - MDN Web Docs Glossary: Definitions of Web-related terms
52 crud glossary, infrastructure crud (create, read, update, delete) is an acronym for ways one can operate on stored data.
... 296 ota glossary, infrastructure, intro, ota, over the air, updates over the air (ota) refers to automatic updating of software on connected devices from a central server.
... all device owners receiving a given set of updates are on the same "channel", and each device often can access several channels (e.g.
...And 7 more matches
How to build custom form controls - Learn web development
we include our control and the <select>; which one is displayed depends on the class of the body element, with the class of the body element being updated by the script that makes the control function, when it loads successfully to achieve this, we need two things: first, we need to add a regular <select> element before each instance of our custom control.
... // we deactivate the control deactivateselect(select); }); // loose focus if the user hits `esc` select.addeventlistener('keyup', function (event) { // deactive on keyup of `esc` if (event.keycode === 27) { deactivateselect(select); } }); }); at that point, our control will change state according to our design, but its value doesn't get updated yet.
... live example check out the source code handling the control's value now that our control is working, we have to add code to update its value according to user input and make it possible to send the value along with form data.
...And 7 more matches
Drawing graphics - Learn web development
update your ctx.drawimage() line like so: ctx.drawimage(image, 20, 20, 185, 175, 50, 50, 185, 175); the first parameter is the image reference, as before.
... loops and animations we have so far covered some very basic uses of 2d canvas, but really you won't experience the full power of canvas unless you update or animate it in some way.
... update the variables that describe the sequence of triangles, so we can be ready to draw the next one.
...And 7 more matches
Client-Server Overview - Learn web development
a method that defines the required action (for example, to get a file or to save or update some data).
...you might for example use a head request to find out the last time a resource was updated, and then only use the (more "expensive") get request to download the resource if it has changed.
... put: update an existing resource (or create a new one if it doesn't exist).
...And 7 more matches
McCoy
mccoy is an application that allows add-on authors to provide secure updates to their users.
... applications periodically look for and install updates to their add-ons.
... it's important that the update information retrieved has not been tampered with since being written by the add-on author.
...And 7 more matches
NSS_3.12_release_notes.html
bug 391292: shared database implementation slow bug 391294: shared database implementation really slow on network file systems bug 392521: automatic shared db update fails if user opens database r/w but never supplies a password bug 392522: integrity hashes must be updated when passwords are changed.
...ing aia url with ocsp access method bug 390233: umbrella bug for libpkix cert validation failures discovered from running vfyserv bug 390499: libpkix does not check cached cert chain for revocation bug 390502: libpkix fails cert validation when no valid crl (nist validation policy is always enforced) bug 390530: libpkix does not support time override bug 390536: cert validation functions must validate leaf cert themselves bug 390554: all pkix_nullcheck_ errors are reported as pkix alloc error bug 390888: cert_verify* functions should be able to use libpkix bug 391457: libpkix does not check for object ref leak at shutdown bug 391774: pkix_shutdown is not called by nssinit.c bug 393174: memory leaks in ocspclnt/pkix.
...bug 399326: libpkix is unable to validate cert for certusagestatusresponder bug 400947: thread unsafe operation in pkix_pl_hashtable_add cause selfserv to crash.
...And 7 more matches
nsINavHistoryObserver
method overview void onbeforedeleteuri(in nsiuri auri, in acstring aguid); obsolete since gecko 21.0 void onbeginupdatebatch(); void onclearhistory(); void ondeleteuri(in nsiuri auri, in acstring aguid); void ondeletevisits(in nsiuri auri, in prtime avisittime, in acstring aguid); void onendupdatebatch(); void onpagechanged(in nsiuri auri, in unsigned long awhat, in astring avalue); void onpageexpired(in nsiuri auri, in prtime avisittime, in boolean awholeentr...
... onbeginupdatebatch() notifies you that a batch of things are about to change.
... you should avoid doing any heavy-duty processing until onendupdatebatch() is called.
...And 7 more matches
HTMLImageElement.srcset - Web APIs
the htmlimageelement property srcset is a string which identifies one or more image candidate strings, separated using commas (,) each specifying image resources to use under given circumstances.
... each image candidate string contains an image url and an optional width or pixel density descriptor that indicates the conditions under which that candidate should be used instead of the image specified by the src property.
... syntax htmlimageelement.srcset = imagecandidatestrings; let srcset = htmlimageelement.srcset; value a usvstring containing a comma-separated list of one or more image candidate strings to be used when determining which image resource to present inside the <img> element represented by the htmlimageelement.
...And 7 more matches
IDBObjectStore.put() - Web APIs
the put() method of the idbobjectstore interface updates a given record in a database, or inserts a new record if the given item does not already exist.
... the put method is an update or insert method.
... bear in mind that if you have a idbcursor to the record you want to update, updating it with idbcursor.update() is preferable to using idbobjectstore.put().
...And 7 more matches
HTML documentation index - HTML: Hypertext Markup Language
WebHTMLIndex
6 date and time formats used in html date, element, format, html, iso 8601, input, reference, string, time, week, datetime, datetime-local, del, ins, month, month-year, week-year certain html elements use date and/or time values.
... 50 html attribute: step attribute, attributes, constrain validation, step valid for the numeric input types, including the date, month, week, time, datetime-local, number and range types, the step attribute is a number that specifies the granularity that the value must adhere to or the keyword any.
...if the content is time- or date-related, the <time> element must be used.
...And 7 more matches
Cache-Control - HTTP
cache-control: must-revalidate cache-control: no-cache cache-control: no-store cache-control: no-transform cache-control: public cache-control: private cache-control: proxy-revalidate cache-control: max-age=<seconds> cache-control: s-maxage=<seconds> extension cache-control directives extension cache-control directives are not part of the core http caching standards document.
... cache-control: immutable cache-control: stale-while-revalidate=<seconds> cache-control: stale-if-error=<seconds> directives cacheability a response is normally cached by the browser if: it has a status code of 301, 302, 307, 308, or 410 and cache-control does not have no-store, or if proxy, does not have private and authorization is unset either has a status code of 301, 302, 307, 308, or 410 or has public, max-age or s-maxage in cache-control or has expires set public the response may be stored by any cache, even if the response is normally non-cacheable.
...setting must-revalidate does not make sense because in order to go through revalidation you need the response to be stored in a cache, which no-store prevents.
...And 7 more matches
Expressions and operators - JavaScript
this operator is primarily used inside a for loop, to allow multiple variables to be updated each time through the loop.
... for example, if a is a 2-dimensional array with 10 elements on a side, the following code uses the comma operator to update two variables at once.
... suppose you define the following variables: var myfun = new function('5 + 2'); var shape = 'round'; var size = 1; var foo = ['apple', 'mango', 'orange']; var today = new date(); the typeof operator returns the following results for these variables: typeof myfun; // returns "function" typeof shape; // returns "string" typeof size; // returns "number" typeof foo; // returns "object" typeof today; // returns "object" typeof doesntexist; // returns "undefined" for the keywords true and null, the typeof operator returns the following r...
...And 7 more matches
XUL user interfaces - Archive of obsolete content
g started - xul demonstration" onload="init();"> <script type="application/javascript" src="script7.js"/> <label class="head-1" value="xul demonstration"/> <vbox> <groupbox class="demo-group"> <caption label="day of week calculator"/> <grid> <columns> <column/> <column/> </columns> <rows> <row> <label class="text-prompt" value="date:" accesskey="d" control="date-text"/> <textbox id="date-text" type="timed" timeout="750" oncommand="refresh();"/> </row> <row> <label value="day:"/> <hbox id="day-box"> <label class="day" value="sunday" disabled="true"/> <label class="day" value="monday" disabled="true"/> <label class="day"...
...ue="wednesday" disabled="true"/> <label class="day" value="thursday" disabled="true"/> <label class="day" value="friday" disabled="true"/> <label class="day" value="saturday" disabled="true"/> </hbox> </row> </rows> </grid> <hbox class="buttons"> <button id="clear" label="clear" accesskey="c" oncommand="cleardate();"/> <button id="today" label="today" accesskey="t" oncommand="settoday();"/> </hbox> </groupbox> <statusbar> <statusbarpanel id="status"/> </statusbar> </vbox> </window> make a new css file, style7.css.
...rid { margin-bottom: 1em; } .demo-group column { margin-right: .5em; } .demo-group row { margin-bottom: .5em; } .demo-group .buttons { -moz-box-pack: end; } /* the day-of-week labels */ .day { margin-left: 1em; } .day[disabled] { color: #777; } .day:first-child { margin-left: 4px; } /* the left column labels */ .text-prompt { padding-top: .25em; } /* the date input box */ #date-text { max-width: 8em; } /* the status bar */ statusbar { width: 100%; border: 1px inset -moz-dialog; margin: 4px; padding: 0px 4px; } #status { padding: 4px; } #status[warning] { color: red; } make a new text file, script7.js.
...And 6 more matches
JavaScript Client API - Archive of obsolete content
this document is somewhat outdated, and the api isn't well-supported for use from add-ons; tread carefully.
... the best, and most up-to-date, reference to sync's internal apis is the source code.
... the store must also make updates to the underlying data itself based on incoming record objects.
...And 6 more matches
Sorting Results - Archive of obsolete content
<treecol id="name" label="name" sort="?name" flex="1"/> <treecol id="date" label="date" sort="?date" flex="1"/> in this example, the first column will be sorted by the ?name variable and the second column by the ?date variable.
...if the tree is sorted by name, and the user clicks on the date column header, the sort will change to the date column.
...for instance, in the example the second column sorts by date, but if you were to use a different variable such as ?description, the tree would sort by the value of the description variable for each row.
...And 6 more matches
Mozilla release FAQ - Archive of obsolete content
warning: the content of this article may be out of date.
... it was last updated in 2005.
...as of the time of this update, mozilla 1.0 release candicate 2 is the most recent release.
...And 6 more matches
Building up a basic demo with the PlayCanvas engine - Game development
playcanvas application to begin developing our game we have to create the playcanvas application first (using the given <canvas> element), and then start the update loop.
... var boxmaterial = new pc.phongmaterial(); boxmaterial.diffuse.set(0, 0.58, 0.86); boxmaterial.update(); box.model.model.meshinstances[0].material = boxmaterial; by diffusing the light on the object we can give it it's own color —we'll choose a nice familiar blue.
... after the material is created and its color is set, it has to be updated so our changes are going to be applied.
...And 6 more matches
2D maze game with device orientation - Game development
with every asset loaded you can see more of the preloadbar image: from 0% to 100%, updated on every frame.
...in particular, take note of the update() function (executed at every frame), which updates things such as the ball position.
... ball.game = function(game) {}; ball.game.prototype = { create: function() {}, initlevels: function() {}, showlevel: function(level) {}, updatecounter: function() {}, managepause: function() {}, manageaudio: function() {}, update: function() {}, wallcollision: function() {}, handleorientation: function(e) {}, finishlevel: function() {} }; the create and update functions are framework-specific, while others will be our own creations: initlevels initializes the level data.
...And 6 more matches
Looping code - Learn web development
let's say we wanted to draw 100 random circles on a <canvas> element (press the update button to run the example again and again to see different random sets): hidden code <!doctype html> <html> <head> <meta charset="utf-8"> <title>random canvas circles</title> <style> html { width: 100%; height: inherit; background: #ddd; } canvas { display: block; } body { margin: 0; } button { ...
... position: absolute; top: 5px; left: 5px; } </style> </head> <body> <button>update</button> <canvas></canvas> <script> const btn = document.queryselector('button'); const canvas = document.queryselector('canvas'); const ctx = canvas.getcontext('2d'); let width = document.documentelement.clientwidth; let height = document.documentelement.clientheight; canvas.width = width; canvas.height = height; function random(number) { return math.floor(math.random()*number); } function draw() { ctx.clearrect(0,0,width,height); for (let i = 0; i < 100; i++) { ctx.beginpath(); ctx.fillstyle = 'rgba(255,0,0,0.5)'; ctx.arc(random(width), random(height), random(50), 0, 2 * math.pi...
...ns-serif; } h2 { font-size: 16px; } .a11y-label { margin: 0; text-align: right; font-size: 0.7rem; width: 98%; } body { margin: 10px; background: #f5f9fa; } const textarea = document.getelementbyid('code'); const reset = document.getelementbyid('reset'); const solution = document.getelementbyid('solution'); let code = textarea.value; let userentry = textarea.value; function updatecode() { eval(textarea.value); } reset.addeventlistener('click', function() { textarea.value = code; userentry = textarea.value; solutionentry = jssolution; solution.value = 'show solution'; updatecode(); }); solution.addeventlistener('click', function() { if(solution.value === 'show solution') { textarea.value = solutionentry; solution.value = 'hide solution'; } else { ...
...And 6 more matches
Focus management with Vue refs - Learn web development
any updates are first performed on the in-memory nodes, and then all the changes that need to be made to the actual nodes on the page are synced in a batch.
...update it like this: <button type="button" class="btn" ref="editbutton" @click="toggletoitemeditform"> edit <span class="visually-hidden">{{label}}</span> </button> to access the value associated with our ref, we use the $refs property provided on our component instance.
...because vue is trying to optimize and batch changes, it won't immediately update the dom when we set isediting to false.
...And 6 more matches
MediaDevices.ondevicechange - Web APIs
you can at any time use enumeratedevices() to get the updated list of available devices.
...there is no information about the change included in the event object; to get the updated list of devices, you'll have to use enumeratedevices().
... example in this example, we create a function called updatedevicelist(), which is called once when mediadevices.getusermedia() successfully obtains a stream, and then is called any time the device list changes.
...And 6 more matches
Capabilities, constraints, and settings - Web APIs
you can also change the constraints of an existing mediastreamtrack on the fly, by calling the track's applyconstraints() method, passing into it an object representing the constraints you wish to apply to the track: videotrack.applyconstraints({ width: 1920, height: 1080 }); in this snippet, the video track referenced by videotrack is updated so that its resolution as closely as possible matches 1920x1080 pixels (1080p high definition).
... function switchcameras(track, camera) { let constraints = track.getconstraints(); constraints.facingmode = camera; track.applyconstraints(constraints); } this function accepts a mediastreamtrack and a string indicating the camera facing mode to use, fetches the current constraints, sets the value of the mediatrackconstraints.facingmode to the specified value, then applies the updated constraint set.
...this display is updated by the function getcurrentsettings(), which gets the current settings for the audio and video tracks and inserts the corresponding code into the tracks' settings display boxes by setting their value.
...And 6 more matches
WebRTC API - Web APIs
rtcicecandidate represents a candidate interactive connectivity establishment (ice) server for establishing an rtcpeerconnection.
... rtcpeerconnectioniceevent represents events that occur in relation to ice candidates with the target, usually an rtcpeerconnection.
... only one event is of this type: icecandidate.
...And 6 more matches
Using XMLHttpRequest - Web APIs
load the transfer is complete; all data is now in the response var oreq = new xmlhttprequest(); oreq.addeventlistener("progress", updateprogress); oreq.addeventlistener("load", transfercomplete); oreq.addeventlistener("error", transferfailed); oreq.addeventlistener("abort", transfercanceled); oreq.open(); // ...
... // progress on transfers from the server to the client (downloads) function updateprogress (oevent) { if (oevent.lengthcomputable) { var percentcomplete = oevent.loaded / oevent.total * 100; // ...
... the progress event handler, specified by the updateprogress() function in this example, receives the total number of bytes to transfer as well as the number of bytes transferred so far in the event's total and loaded fields.
...And 6 more matches
Constraint validation - Developer guides
therefore, like with html4, you need to also validate input constraints on the server side, in a way that is consistent with what is done on the client side.
... rangeunderflow constraint violation date, month, week a valid date datetime, datetime-local, time a valid date and time max range, number a valid number the value must be less than or equal to the value rangeoverflow constraint violation date, month, week a valid date datetime, datetime-local, time a valid date and time required text, search, url, tel, email, passwo...
...rd, date, datetime, datetime-local, month, week, time, number, checkbox, radio, file; also on the <select> and <textarea> elements none as it is a boolean attribute: its presence means true, its absence means false there must be a value (if set).
...And 6 more matches
<input type="color"> - HTML: Hypertext Markup Language
WebHTMLElementinputcolor
the element's presentation may vary substantially from one browser and/or platform to another—it might be a simple textual input that automatically validates to ensure that the color information is entered in the proper format, or a platform-standard color picker, or some kind of custom color picker window.
... providing a default color you can update the simple example above to set a default value, so that the color well is pre-filled with the default color and the color picker (if any) will also default to that color: <input type="color" value="#ff0000"> if you don't specify a value, the default is #000000, which is black.
... here's an example that watches changes over time to the color value: colorpicker.addeventlistener("input", updatefirst, false); colorpicker.addeventlistener("change", watchcolorpicker, false); function watchcolorpicker(event) { document.queryselectorall("p").foreach(function(p) { p.style.color = event.target.value; }); } selecting the value if the <input> element's implementation of the color type on the user's browser doesn't support a color well, but is instead a text field for entering the col...
...And 6 more matches
href - SVG: Scalable Vector Graphics
WebSVGAttributehref
candidate recommendation defines href for the <a> element.
... candidate recommendation defines href for the <feimage> element.
... candidate recommendation defines href for the <image> element.
...And 6 more matches
Chapter 5: Let's build a Firefox extension - Archive of obsolete content
script" src="chrome://helloworld/content/clock.js"/> <hbox align="center"> <label value="current time:" /> <textbox id="currenttime" /> </hbox> </dialog> listing 6: content for clock.js function initclock() { showcurrenttime(); window.setinterval(showcurrenttime, 1000); } function showcurrenttime() { var textbox = document.getelementbyid("currenttime"); textbox.value = new date().tolocaletimestring(); textbox.select(); } operations check perform an operations check to make sure that your changes to the source file are correct.
... fixme: figure 10: directory structure with skin package added add the skin package update chrome.manifest with the contents of listing 10.
... add the toolbar button to add the toolbar button to the browser window, update overlay.xul as shown in listing 11.
...And 5 more matches
Gecko Compatibility Handbook - Archive of obsolete content
they are actually replaced by ''-(example removed)-'' the goal of this handbook is to help you update websites to work with standards-based browsers and properly detect gecko.
...this compatibility test will be most beneficial to sites using simple code or that have updated to support standards.
...detecting gecko instead is the easy way to fix this as well as accomodate users of mozilla, compuserve 7, etc.
...And 5 more matches
What is RSS - Archive of obsolete content
for example: <?xml version="1.0"?> <rss version="2.0"> <channel> <title>example news site</title> <description>this is an example news site.</description> <lastbuilddate>wed, 27 jul 2005 00:30:30 -0700</lastbuilddate> <link>http://news.example.com/</link> <item> <title>news flash: i like bread</title> <guid ispermalink="false">4d4a0a12-f188-4c97-908b-eea27213c2fe</guid> <pubdate>wed, 27 jul 2005 00:30:30 -0700</pubdate> <link>http://news.example.com/artcle/554</link> </item> <item> ...
... <title>big news today: birds fly</title> <guid ispermalink="false">c4a63f09-b45b-466b-8773-6ff264001ab7</guid> <pubdate>tue, 19 jul 2005 04:32:51 -0700</pubdate> <link>http://news.example.com/artcle/553</link> </item> <item> <title>fire is hot</title> <guid ispermalink="false">c1795324-d5ea-44fa-95b1-b5ce2090d4f1</guid> <pubdate>sun, 15 may 2005 13:02:08 -0700</pubdate> <link>http://news.example.com/artcle/552</link> </item> </channel> </rss> bloggers use rss to provide everyone with a list of their newest blog posts.
... for example: <?xml version="1.0"?> <rss version="2.0"> <channel> <title>joe blow's blog</title> <description>this is the weblog of joe blow</description> <lastbuilddate>sun, 15 may 2005 13:02:08 -0500</lastbuilddate> <link>http://joe-blow.example.net/</link> <item> <title>i be blogging...</title> <guid>http://joe-blow.example.net/log/21</guid> <pubdate>sun, 15 may 2005 13:02:08 -0500</pubdate> <link>http://joe-blow.example.net/log/21</link> </item> <item> <title>i am so smrt</title> <guid>http://joe-blow.example.net/log/20</guid> <pubdate>sat, 14 may 2005 22:19:18 -0500</pubdate> <link>http://joe-blow.example.net/log/20</link> </i...
...And 5 more matches
Using workers in extensions - Archive of obsolete content
how this differs from previous versions this version of the stock ticker extension moves the xmlhttprequest call that fetches updated stock information into a worker thread, which then passes that information back to the main body of the extension's code to update the display in the status bar.
... the worker the worker thread's job in this example is to issue the xmlhttprequest calls that fetch the updated stock information.
...this provides a way for the main thread to specifically request that the worker update the stock information at once.
...And 5 more matches
Reference - Archive of obsolete content
once that is done, the various code samples should be updated to reflect current practices and code if they cannot be written in a "version-neutral" manner.
...a subset of the "object > (function, everything else)" chain could be object > function > (object, function, array, string, boolean, number, date, regexp, error).
...compare this to the date object.
...And 5 more matches
XForms Custom Controls - Archive of obsolete content
we will also show you how to create custom controls that work with the xforms model and are automatically updated just like xforms controls.
...for example, if you have an instance node of type xsd:date and you'd like to see the date displayed in a local format.
...this will also allow you to be up to date with our current approaches (often the result of hard-learned lessons) and that will hopefully help you to more easily write your own controls.
...And 5 more matches
Parsing microformats in JavaScript - Archive of obsolete content
methods datetimegetter() specifically retrieves a date from a microformat node.
... after getting the text, it is normalized into an iso 8601 date.
... normalizeddate = microformats.parser.datetimegetter(propnode, parentnode); parameters propnode the dom node to check.
...And 5 more matches
Advanced form styling - Learn web development
<input type="color"> date-related controls such as <input type="datetime-local"> <input type="range"> <input type="file"> <progress> and <meter> let's first talk about the appearance property, which is pretty useful for making all of the above more stylable.
... for example, let's take the following controls: <form> <p> <label for="search">search: </label> <input id="search" name="search" type="search"> </p> <p> <label for="text">text: </label> <input id="text" name="text" type="text"> </p> <p> <label for="date">date: </label> <input id="date" name="date" type="datetime-local"> </p> <p> <label for="radio">radio: </label> <input id="radio" name="radio" type="radio"> </p> <p> <label for="checkbox">checkbox: </label> <input id="checkbox" name="checkbox" type="checkbox"> </p> <p><input type="submit" value="submit"></p> <p><input type="button" value="button"></p> </form> ap...
...in short, these are drop-down boxes, complex control types like color and datetime-local, and feedback—oriented controls like <progress> and <meter>.
...And 5 more matches
Cooperative asynchronous JavaScript: Timeouts and intervals - Learn web development
the following function creates a new date() object, extracts a time string out of it using tolocaletimestring(), and then displays it in the ui.
... it then runs the function once per second using setinterval(), creating the effect of a digital clock that updates once per second (see this live, and also see the source): function displaytime() { let date = new date(); let time = date.tolocaletimestring(); document.getelementbyid('demo').textcontent = time; } const createclock = setinterval(displaytime, 1000); just like settimeout(), setinterval() returns an identifying value you can use later when you need to clear the interval.
... it is easier to create this example without using a date() object, like we've done in our version, but less accurate — you can't guarantee that the callback will fire after exactly 1000ms.
...And 5 more matches
Arrays - Learn web development
al.tofixed(2); </textarea> <div class="playable-buttons"> <input id="reset" type="button" value="reset"> <input id="solution" type="button" value="show solution"> </div> const textarea = document.getelementbyid('code'); const reset = document.getelementbyid('reset'); const solution = document.getelementbyid('solution'); let code = textarea.value; let userentry = textarea.value; function updatecode() { eval(textarea.value); } reset.addeventlistener('click', function() { textarea.value = code; userentry = textarea.value; solutionentry = jssolution; solution.value = 'show solution'; updatecode(); }); solution.addeventlistener('click', function() { if(solution.value === 'show solution') { textarea.value = solutionentry; solution.value = 'hide solution'; } else { ...
... textarea.value = userentry; solution.value = 'show solution'; } updatecode(); }); const jssolution = 'const list = document.queryselector(\'.output ul\');\nconst totalbox = document.queryselector(\'.output p\');\nlet total = 0;\nlist.innerhtml = \'\';\ntotalbox.textcontent = \'\';\n\nlet products = [\'underpants:6.99\',\n \'socks:5.99\',\n \'t-shirt:14.99\',\n \'trousers:31.99\',\n \'shoes:23.99\'];\n\nfor(let i = 0; i < products.length; i++) {\n let subarray = products[i].split(\':\');\n let name = subarray[0];\n let price = number(subarray[1]);\n total += price;\n let itemtext = name + \' — $\' + price;\n\n let listitem = document.createelement(\'li\');\n listitem.textcontent = itemtext;\n list.appendchild(listitem);\n}\n\ntotalbox.textcontent = \'total: $\' + total...
....tofixed(2);'; let solutionentry = jssolution; textarea.addeventlistener('input', updatecode); window.addeventlistener('load', updatecode); // stop tab key tabbing out of textarea and // make it write a tab at the caret position instead textarea.onkeydown = function(e){ if (e.keycode === 9) { e.preventdefault(); insertatcaret('\t'); } if (e.keycode === 27) { textarea.blur(); } }; function insertatcaret(text) { const scrollpos = textarea.scrolltop; const caretpos = textarea.selectionstart; const front = (textarea.value).substring(0, caretpos); const back = (textarea.value).substring(textarea.selectionend, textarea.value.length); textarea.value = front + text + back; caretpos = caretpos + text.length; textarea.selectionstart = caretpos; textarea.selecti...
...And 5 more matches
Adding features to our bouncing balls demo - Learn web development
the ball draw(), update(), and collisiondetect() method definitions should be able to stay exactly the same as they were before.
... checkbounds() this method will do the same thing as the first part of ball()'s update() function — look to see whether the evil circle is going to go off the edge of the screen, and stop it from doing so.
... again, you can mostly just copy the ball.prototype.update definition, but there are a few changes you should make: get rid of the last two lines — we don't want to automatically update the evil circle's position on every frame, because we will be moving it in some other way, as you'll see below.
...And 5 more matches
React interactivity: Editing, filtering, conditional rendering - Learn web development
it’ll be similar to deletetask() because it'll take an id to find its target object, but it'll also take a newname property containing the name to update the task to.
... update the "edit" button in the viewtemplate like so: <button type="button" classname="btn" onclick={() => setediting(true)}> edit <span classname="visually-hidden">{props.name}</span> </button> now we'll add the same onclick handler to the "cancel" button in the editingtemplate, but this time we'll set isediting to false so that it switches us back to the view template.
... update the "cancel" button in the edittemplate like so: <button type="button" classname="btn todo-cancel" onclick={() => setediting(false)} > cancel <span classname="visually-hidden">renaming {props.name}</span> </button> with this code in place, you should be able to press the "edit" and "cancel" buttons in your todo items to toggle between templates.
...And 5 more matches
Vue conditional rendering: editing existing todos - Learn web development
to do this, we will take advantage of vue's conditional rendering capabilities — namely v-if and v-else — to allow us to toggle between the existing todo item view, and an edit view where you can update todo item labels.
... update your todoitem’s template as shown below.
...in this handler we’ll emit an item-deleted event to our parent component so the list can be updated.
...And 5 more matches
Handling common HTML and CSS problems - Learn web development
a good strategy is to validate your code regularly.
...to show you an example of how such plugins generally work: install atom (if you haven't got an up-to-date version already installed) — download it from the atom page linked above.
... html5 form elements also exhibit fallback qualities — html5 introduced some special <input> types for inputting specific information into forms, such as times, dates, colors, numbers, etc.
...And 5 more matches
Performance best practices for Firefox front-end engineers
it is expected that over time, script will update the dom, requiring us to recalculate styles.
... it is expected that over time, script will update the dom, requiring us to recalculate styles, and then update layout.
...uninterruptible reflow occurs when some dom node’s styles have changed such that the size or position of one or more nodes in the document will need to be updated, and then javascript asks for the size or position of anything.
...And 5 more matches
Addon
overview of required methods void iscompatiblewith(in string appversion, in string platformversion) void findupdates(in updatelistener listener, in integer reason, in string appversion, in string platformversion) overview of optional methods void uninstall() void canceluninstall() boolean hasresource(in string path) nsiuri getresourceuri(in string path) void getdatadirectory(in datadirectorycallback callback) required properties attribute ...
... providesupdatessecurely read only boolean true if the add-on has a secure means of updating or cannot be updated at all.
... applybackgroundupdates integer indicates whether updates found in the background for this add-on will be applied automatically.
...And 5 more matches
Localization content best practices
this would waste everybody's time and create unnecessary frustration: localizers have to translate strings that are destined to change, developers will need to use new ids later to update them.
... date and time formats for example, you shouldn't hard code date formats into applications: %a, %b %e // resulting in wednesday, may 20 this is fine in english, but in italian results in "mercoledì, mag 20", which sounds unnatural.
... changing existing strings updating entity names if you are changing a string such that its meaning has changed, you must update the entity or property name for the string to match the new meaning.
...And 5 more matches
Enc Dec MAC Output Public Key as CSR
null, keysize, keyid, pr_false, pwdata); if (!key) { pr_fprintf(pr_stderr, "symmetric key generation failed \n"); } return key; } /* * macinit */ secstatus macinit(pk11context *ctx) { secstatus rv = pk11_digestbegin(ctx); if (rv != secsuccess) { pr_fprintf(pr_stderr, "compute mac failed : pk11_digestbegin()\n"); } return rv; } /* * macupdate */ secstatus macupdate(pk11context *ctx, unsigned char *msg, unsigned int msglen) { secstatus rv = pk11_digestop(ctx, msg, msglen); if (rv != secsuccess) { pr_fprintf(pr_stderr, "compute mac failed : digestop()\n"); } return rv; } /* * finalize macing */ secstatus macfinal(pk11context *ctx, unsigned char *mac, unsigned int *maclen, unsigned int maxle...
... pr_fprintf(pr_stderr, "compute mac failed : pk11_digestfinal()\n"); } return secsuccess; } /* * compute mac */ secstatus computemac(pk11context *ctxmac, unsigned char *ptext, unsigned int ptextlen, unsigned char *mac, unsigned int *maclen, unsigned int maxlen) { secstatus rv = macinit(ctxmac); if (rv != secsuccess) return rv; rv = macupdate(ctxmac, ptext, ptextlen); if (rv != secsuccess) return rv; rv = macfinal(ctxmac, mac, maclen, maxlen); return rv; } /* * writetoheaderfile */ secstatus writetoheaderfile(const char *buf, unsigned int len, headertype type, prfiledesc *outfile) { secstatus rv; const char *header; const char *trailer; switch (type) { case symkey: ...
...ams rsaparams; void *params; seckeyprivatekey *privkey = null; secstatus rv; unsigned char randbuf[blocksize + 1]; rv = generaterandom(randbuf, blocksize); if (rv != secsuccess) { fprintf(stderr, "error while generating the random numbers : %s\n", port_errortostring(rv)); goto cleanup; } pk11_randomupdate(randbuf, blocksize); switch (keytype) { case rsakey: rsaparams.keysizeinbits = size; rsaparams.pe = publicexponent; mechanism = ckm_rsa_pkcs_key_pair_gen; algtag = sec_oid_pkcs1_md5_with_rsa_encryption; params = &rsaparams; break; default: ...
...And 5 more matches
NSS tools : crlutil
list of possible algorithms: md2 | md4 | md5 | sha1 | sha256 | sha384 | sha512 -n nickname specify the nickname of a certificate or key to list, create, add to a database, modify, or validate.
... crl generation script syntax crl generation script file has the following syntax: * line with comments should have # as a first symbol of a line * set "this update" or "next update" crl fields: update=yyyymmddhhmmssz nextupdate=yyyymmddhhmmssz field "next update" is optional.
... * add certificate entries(s) to crl: addcert range date range: two integer values separated by dash: range of certificates that will be added by this command.
...And 5 more matches
sslfnc.html
it causes dynamic linking issues at run-time after an update of nss because the actual size of the array changes between releases.
... checksig pr_true means signatures are to be checked and the certificate chain is to be validated.
... checksig pr_true means signatures are to be checked and the certificate chain is to be validated.
...And 5 more matches
Utility functions
hash_gethashtypebyoidtag mxr 3.8 and later hash_gettype mxr 3.12 and later hash_hashbuf mxr 3.10 and later hash_resultlen mxr 3.4 and later hash_resultlenbyoidtag mxr 3.10 and later hash_resultlencontext mxr 3.10 and later hash_update mxr 3.4 and later nss_init mxr 3.2 and later nss_initialize mxr 3.2 and later nss_initreadwrite mxr 3.2 and later nss_initwithmerge mxr 3.12 and later nss_isinitialized mxr 3.9.2 and later nss_nodb_init mxr 3.2 and late...
... 3.2 and later nss_unregistershutdown mxr 3.11.1 and later nss_versioncheck mxr 3.2 and later nssbase64_decodebuffer mxr 3.4 and later nssbase64decoder_create mxr 3.2 and later nssbase64decoder_destroy mxr 3.2 and later nssbase64decoder_update mxr 3.2 and later nssbase64_encodeitem mxr 3.4 and later nssbase64encoder_create mxr 3.2 and later nssbase64encoder_destroy mxr 3.2 and later nssbase64encoder_update mxr 3.2 and later nssrwlock_destroy mxr 3.2 and later nssrwlock_h...
...ater sec_asn1decoderclearnotifyproc mxr 3.2 and later sec_asn1decoderfinish mxr 3.2 and later sec_asn1decodersetfilterproc mxr 3.2 and later sec_asn1decodersetnotifyproc mxr 3.2 and later sec_asn1decoderstart mxr 3.2 and later sec_asn1decoderupdate mxr 3.2 and later sec_asn1encode mxr 3.2 and later sec_asn1encodeinteger mxr 3.2 and later sec_asn1encodeitem mxr 3.2 and later sec_asn1encoderabort mxr 3.9 and later sec_asn1encoderclearnotifyproc mxr 3.2 and later sec_asn1encoder...
...And 5 more matches
NSS tools : crlutil
MozillaProjectsNSStoolscrlutil
list of possible algorithms: md2 | md4 | md5 | sha1 | sha256 | sha384 | sha512 -n nickname specify the nickname of a certificate or key to list, create, add to a database, modify, or validate.
... crl generation script syntax crl generation script file has the following syntax: * line with comments should have # as a first symbol of a line * set "this update" or "next update" crl fields: update=yyyymmddhhmmssz nextupdate=yyyymmddhhmmssz field "next update" is optional.
... * add certificate entries(s) to crl: addcert range date range: two integer values separated by dash: range of certificates that will be added by this command.
...And 5 more matches
Redis Tips
i mean counters you can update atomically.
... > var r = require('redis').createclient(); // and i'll define these utility functions just for this example > function now() { return (new date()).gettime() / 1000 } > function print(err, results) { console.log(json.stringify(results, null, 2)) } whenever someone logs into my site, i record them in my 'last-login' zset.
... here's what the zset contains now: > r.zrange('last-login', 0, -1, print); // remember, i defined 'print' above ["jparsons", "zcarter", "lloyd"] since this is a set, lloyd only appears once, with updated login timestamp.
...And 5 more matches
nsIDOMMozNetworkStatsManager
the query may be filtered by connection type and date.
... start a date object representing the beginning of data measurement.
... end a date object representing the end of data measurement.
...And 5 more matches
nsINavHistoryQueryOptions
instead, we get the result ordered by date, pick the maxresult most recent ones, and then sort by title.
...only matters when sorting by date.
... sort_by_date_ascending 3 sort by the ascending date order.
...And 5 more matches
nsITreeBoxObject
id ensurecellisvisible(in long row, in nsitreecolumn col); void scrolltorow(in long index); void scrollbylines(in long numlines); void scrollbypages(in long numpages); void scrolltocell(in long row, in nsitreecolumn col); void scrolltocolumn(in nsitreecolumn col); void scrolltohorizontalposition(in long horizontalposition); void invalidate(); void invalidatecolumn(in nsitreecolumn col); void invalidaterow(in long index); void invalidatecell(in long row, in nsitreecolumn col); void invalidaterange(in long startindex, in long endindex); void invalidatecolumnrange(in long startindex, in long endindex, in nsitreecolumn col); long getrowat(in long x, in long y); void getcell...
...at(in long x, in long y, out long row, out nsitreecolumn col, out acstring childelt); void getcoordsforcellitem(in long row, in nsitreecolumn col, in acstring element, out long x, out long y, out long width, out long height); boolean iscellcropped(in long row, in nsitreecolumn col); void rowcountchanged(in long index, in long count); void beginupdatebatch(); void endupdatebatch(); void clearstyleandimagecaches(); attributes attribute type description columns nsitreecolumns readonly: obtain the columns.
... void scrolltohorizontalposition(in long horizontalposition); parameters horizontalposition the number of pixels to scroll invalidate() invalidatecolumn() invalidaterow() invalidatecell() invalidaterange() invalidatecolumnrange() invalidation methods for fine-grained painting control.
...And 5 more matches
Using IndexedDB - Web APIs
if the database does exist but you are specifying an upgraded version number, an onupgradeneeded event is triggered straight away, allowing you to provide an updated schema in its handler.
...const customerdata = [ { ssn: "444-44-4444", name: "bill", age: 35, email: "bill@company.com" }, { ssn: "555-55-5555", name: "donna", age: 32, email: "donna@home.org" } ]; of course, you wouldn't use someone's social security number as the primary key to a customer table because not everyone has a social security number, and you would store their birth date instead of their age, but let's ignore those unfortunate choices for the sake of convenience and move along.
...let's update the previous example somewhat: var objectstore = db.transaction(["customers"], "readwrite").objectstore("customers"); var request = objectstore.get("444-44-4444"); request.onerror = function(event) { // handle errors!
...And 5 more matches
RTCConfiguration.iceTransportPolicy - Web APIs
syntax let rtcconfiguration = { icetransportpolicy: policy }; rtcconfiguration.icetransportpolicy = policy; let policy = rtcconfiguration.icetransportpolicy; value a domstring which indicates what ice candidate policy the ice agent should use during the negotiation process, per the jsep standard.
... the permitted values are: all the ice agent is permitted to use any kind of candidate, including both local and relay candidates.
... the agent—or the browser itself—may still perform some form of ip filtering on the incoming candidates for reasons including privacy and security, as well as to simply limit the number of candidates.
...And 5 more matches
RTCIceTransport.ongatheringstatechange - Web APIs
the gathering state indicates whether or not the ice agent has begun gathering candidates, and if so, whether or not gathering has finished.
... its possible values are: "new" the rtcicetransport is newly created and has not yet started to gather ice candidates.
... "gathering" the transport is in the process of gathering candidates.
...And 5 more matches
RTCPeerConnection.iceConnectionState - Web APIs
constant description "new" the ice agent is gathering addresses or is waiting to be given remote candidates through calls to rtcpeerconnection.addicecandidate() (or both).
... "checking" the ice agent has been given one or more remote candidates and is checking pairs of local and remote candidates against one another to try to find a compatible match, but has not yet found a pair which will allow the peer connection to be made.
... it's possible that gathering of candidates is also still underway.
...And 5 more matches
RTCPeerConnection: icegatheringstatechange event - Web APIs
the icegatheringstatechange event is sent to the onicegatheringstatechange event handler on an rtcpeerconnection when the state of the ice candidate gathering process changes.
... when ice firststarts to gather connection candidates, the value changes from new to gathering to indicate that the process of collecting candidate configurations for the connection has begun.
... when the value changes to complete, all of the transports that make up the rtcpeerconnection have finished gathering ice candidates.
...And 5 more matches
A simple RTCDataChannel sample - Web APIs
set up the ice candidates the next step is to set up each connection with ice candidate listeners; these will be called when there's a new ice candidate to tell the other side about.
... note: in a real-world scenario in which the two peers aren't running in the same context, the process is a bit more involved; each side provides, one at a time, a suggested way to connect (for example, udp, udp with a relay, tcp, etc.) by calling rtcpeerconnection.addicecandidate(), and they go back and forth until agreement is reached.
... localconnection.onicecandidate = e => !e.candidate || remoteconnection.addicecandidate(e.candidate) .catch(handleaddcandidateerror); remoteconnection.onicecandidate = e => !e.candidate || localconnection.addicecandidate(e.candidate) .catch(handleaddcandidateerror); we configure each rtcpeerconnection to have an event handler for the icecandidate event.
...And 5 more matches
WebRTC Statistics API - Web APIs
mapping of statistic category names to the dictionaries they implement statistic category name (rtcstatstype) description dictionaries implemented candidate-pair statistics describing the change from one rtcicetransport to another, such as during an ice restart.
... rtcicecandidatepairstats rtcstats certificate statistics about a certificate being used by an rtcicetransport.
... rtcinboundrtpstreamstats rtcreceivedrtpstreamstats rtcrtpstreamstats rtcstats local-candidate statistics about a local ice candidate associated with the connection's rtcicetransports.
...And 5 more matches
ARIA Test Cases - Accessibility
introduction the information on this page is out of date: it was last updated november 2010.
... for more up-to-date examples, see the openajaxalliance aria examples page.
... - - - voiceover (leopard) n/a n/a - fail window-eyes - - - - nvda - n/a - - zoom (leopard) pass n/a pass pass zoomtext - - - - orca - - - - datepicker testcases: datepicker example expected at behavior: markup used: notes: results: at firefox ie opera safari jaws 9 - - n/a n/a jaws 10 - - - voiceover (leopard) n/a n/a - fail window-eyes - - - - nvda - n/a - - zoom (leopard) pass n/a pa...
...And 5 more matches
ARIA annotations - Accessibility
aria-details has been updated so that it can support multiple ids — this makes sense, for example you can easily envisage having multiple comments relating to the same bit of text.
...description-id"> <!-- some kind of ui feature that needs an accessible description --> </div> aria-details is appropriate when linking to descriptions or annotations that are a bit more complex — rather than a simple text string, it might contain multiple bits of semantic information: <div id="detail-id"> <h2>a heading</h2> <p>an extended text description of some kind…</p> <p><time datetime="...">a timestamp</time></p> </div> <div aria-details="detail-id"> <!-- some kind of ui feature that needs an accessible description --> </div> this difference really becomes apparent when you get to how the content is actually interpreted in the accessibility layer, and read out by screenreaders.
...</p> <div id="comment-source">suggested by chris, <time datetime="2019-03-30t19:29">march 30 2019, 19:29</time></div> browsers tend to provide a default black strikethrough for deletions, and a black underline for insertions, but you’ll probably want to use some more interesting styling of your own, for example: ins, [role="insertion"] { color: #0c0; text-decoration: underline; } del, [role="deletion"] { color: red; text-decoration: line-throu...
...And 5 more matches
Web applications and ARIA FAQ - Accessibility
along with placing them directly in the markup, aria attributes can be added to the element and updated dynamically using javascript code like this: // find the progress bar <div> in the dom.
...progressbar.setattribute("role", "progressbar"); progressbar.setattribute("aria-valuemin", 0); progressbar.setattribute("aria-valuemax", 100); // create a function that can be called at any time to update the value of the progress bar.
... function updateprogress(percentcomplete) { progressbar.setattribute("aria-valuenow", percentcomplete); } will adding aria change my page styles or behavior?
...And 5 more matches
<input type="time"> - HTML: Hypertext Markup Language
WebHTMLElementinputtime
12-hour 24-hour chrome 83 in chrome 83, the ui controls have been updated with a new look and feel.
... events change and input supported common attributes autocomplete, list, readonly, and step idl attributes value, valueasdate, valueasnumber, and list.
...you can set a default value for the input by including a valid time in the value attribute when creating the <input> element, like so: <label for="appt-time">choose an appointment time: </label> <input id="appt-time" type="time" name="appt-time" value="13:30"> you can also get and set the date value in javascript using the htmlinputelement.value property, for example: var timecontrol = document.queryselector('input[type="time"]'); timecontrol.value = '15:30'; time value format the value of the time input is always in 24-hour format that includes leading zeros: hh:mm, regardless of the input format, which is likely to be selected based on the user's locale (or by the user agent).
...And 5 more matches
<time> - HTML: Hypertext Markup Language
WebHTMLElementtime
it may include the datetime attribute to translate dates into machine-readable format, allowing for better search engine results or custom features such as reminders.
... a precise date in the gregorian calendar (with optional time and timezone information).
... datetime this attribute indicates the time and/or date of the element and must be in one of the formats described below.
...And 5 more matches
Index - HTTP
WebHTTPHeadersIndex
57 date general header, http, reference, header the date general http header contains the date and time at which the message was originated.
...on the other side, if the content has changed, etags are useful to help prevent simultaneous updates of a resource from overwriting each other ("mid-air collisions").
... 62 expires caching, http, response, header the expires header contains the date/time after which the response is considered stale.
...And 5 more matches
HTTP headers - HTTP
WebHTTPHeaders
expires the date/time after which the response is considered stale.
...if width occurs in a message more than once, the last value overrides all previous occurrences conditionals last-modified the last modification date of the resource, used to compare several versions of the same resource.
...this is used to update caches (for safe requests), or to prevent to upload a new resource when one already exists.
...And 5 more matches
context-menu - Archive of obsolete content
this example updates the item's label based on the number of times it's been clicked: var numclicks = 0; var myitem = require("sdk/context-menu").item({ label: "click me: " + numclicks, contentscript: 'self.on("click", self.postmessage);', onmessage: function () { numclicks++; this.label = "click me: " + numclicks; // setting myitem.label is equivalent.
... } }); sometimes you might want to update the label based on the context.
...you can set this after creating the item to update its label later.
...And 4 more matches
package.json - Archive of obsolete content
updatekey same as the updatekey in an install.rdf file.
... see supporting updates for self-hosted add-ons.
... updatelink same as the updatelink for an update.rdf file.
...And 4 more matches
Forms related code snippets - Archive of obsolete content
date picker (before implementing it in a working environment, please read the note about the const statement compatibility) <!doctype html> <html> <head> <meta http-equiv="content-type" content="text/html; charset=utf-8" /> <title>datepicker example - mdn</title> <script type="text/javascript"> /*\ |*| |*| datepicker example mdndeveloper network |*| |*| https://developer.mozilla.org/docs/code_snippets/forms |*| https://developer.mozilla.org/user:fusionchess |*| |*| this snippet is released under the gnu public license, version 3 or later.
... |*| http://www.gnu.org/licenses/gpl-3.0-standalone.html |*| \*/ (function () { function datepicker (otarget) { const otable = document.createelement("table"), ohrow = document.createelement("tr"), othead = document.createelement("thead"), ocapt = document.createelement("caption"), odecryear = document.createelement("span"), oincryear = document.createelement("span"), odecrmonth = document.createelement("span"), oincrmonth = document.createelement("span"); var nid = ainstances.length, oth; this.target = otarget; this.display = document.createelement("span"); this.current = new date(); this.container = otable; this.display.classname = sprefs + "-current-month"; this.id = nid; otable.classname = sprefs + "-calendar"; ...
... oth = document.createelement("th"); oth.innerhtml = sdays[nthid]; ohrow.appendchild(oth); } othead.appendchild(ohrow); ocapt.appendchild(odecryear); ocapt.appendchild(odecrmonth); ocapt.appendchild(oincryear); ocapt.appendchild(oincrmonth); ocapt.appendchild(this.display); this.container.appendchild(ocapt); this.container.appendchild(othead); this.current.setdate(1); this.writedays(); otarget.onclick = function () { if (otable.parentnode) { otable.parentnode.removechild(otable); return; } otable.style.zindex = nzindex++; otable.style.position = "absolute"; otable.style.left = otarget.offsetleft + "px"; otable.style.top = (otarget.offsettop + otarget.offsetheight) + "px"; otarget.parentnode...
...And 4 more matches
Enhanced Extension Installation - Archive of obsolete content
if the item is not compatible, the extension system asks the appropriate update service (either the one specified by the item, or the default one) if there is remote compatibility information that supercedes the compatibility information held by the item.
...types are defined in nsiupdateservice.idl on the nsiupdateitem interface.
...the guid and version supplied are validated, and then compatibility is checked for by the new _getinstalldata function.
...And 4 more matches
Chapter 1: Introduction to Extensions - Archive of obsolete content
the add-ons manager handles the following tasks: safely installs and uninstalls add-ons makes sure add-ons are compatible with the version of firefox you're using manages a whitelist of sites trusted for installing add-ons helps troubleshoot add-ons by disabling them and offering a safe mode confirms and runs updates provides access to add-ons' settings dialogs provides access to add-ons' support sites development environment amenities initially, there wasn't adequate documentation available, and extension developers were largely left to fend for themselves1; however, now there's a considerable store of knowledge.
... single feature extensions fixme: update this.
... feature enhancing extensions fixme: update this.
...And 4 more matches
Layout System Overview - Archive of obsolete content
to date the only real use of this multiple presentation ability is seen in printing, where multiple presentations are managed, all connected to the same content model.
...sometimes a content element comes in incrementally, and invalidates the formatting of some of the frames that precede it, frame that have already been formatted.
...conceptually, this could be used to introduce other layout systems, but it might be worth noting that there was no specific facility designed into the layout system to accommodate this.
...And 4 more matches
MenuItems - Archive of obsolete content
you do not need to update the checked attribute as the menuitem will update this automatically before the command event is fired.
... note that the checked state is updated before the command event fires, so if you use the menuitem's checked attribute within the command listener, it will already be in the new state.
... there may be times when you do not want the checkbox state to be updated automatically when the menuitem is activated.
...And 4 more matches
Multiple Rule Example - Archive of obsolete content
ner="?start" child="?photo"/> <triple subject="?photo" predicate="http://purl.org/dc/elements/1.1/title" object="?title"/> <triple subject="?photo" predicate="http://purl.org/dc/elements/1.1/description" object="?description"/> <triple subject="?photo" predicate="http://purl.org/dc/elements/1.1/date" object="?date"/> </conditions> <action> <hbox uri="?photo" class="box-padded"> <vbox> <label value="?title"/> <image src="?photo"/> </vbox> <groupbox> <caption label="photo details"/> <label value="?description"/> <label value="date: ?date"/> </groupbox> ...
... predicate="http://purl.org/dc/elements/1.1/title" object="?phototitle"/> </conditions> <action> <vbox uri="?photo" class="box-padded"> <label value="?phototitle"/> <image src="?photo"/> </vbox> </action> </rule> </template> </vbox> in this example, the first rule matches only those photos with title, description, and date properties.
...the second photo has a title and date but no description, while the third photo has only a title.
...And 4 more matches
calICalendarViewController - Archive of obsolete content
interface code [scriptable, uuid(1f783898-f4c2-4b2d-972e-360e0de38237)] interface calicalendarviewcontroller : nsisupports { void createnewevent (in calicalendar acalendar, in calidatetime astarttime, in calidatetime aendtime); void modifyoccurrence (in caliitemoccurrence aoccurrence, in calidatetime anewstarttime, in calidatetime anewendtime); void deleteoccurrence (in caliitemoccurrence aoccurrence); }; methods createnewevent void createnewevent (in calicalendar acalendar, in calidatetime astarttime, in calidatetime ...
...the calidatetime parameters are optional, but aendtime cannot be included without astarttime.
...the calievent should have its enddate set to aendtime, if this parameter is specified.
...And 4 more matches
Browser Detection and Cross Browser Support - Archive of obsolete content
warning: the content of this article may be out of date.
... this article is outdated, do not follow it.
... build date navigator.productsub is specific to gecko browsers and will return a string containing the date the browser was built in the format ccyymmdd (e.g.
...And 4 more matches
Implementation Status - Archive of obsolete content
processing model (events) section title status notes bugs 4 processing model (events) partial the xforms-recalculate, xforms-revalidate, and xforms-refresh events are not as separated as they should be.
...el-construct-done supported 4.2.3 xforms-ready supported 4.2.4 xforms-model-destruct supported 4.3.1 xforms-rebuild supported 4.3.2 xforms-recalculate supported 4.3.3 xforms-revalidate supported 4.3.4 xforms-refresh supported 4.3.5 xforms-reset supported 4.3.6 xforms-next xforms-previous supported 4.3.7 xforms-focus supported 4.3.8 xforms-help xforms-hint ...
...ement unsupported 4.8 dom interface for access to instance data supported 4.8.1 getinstancedocument() supported 4.8.2 rebuild() supported 4.8.3 recalculate() supported 4.8.4 revalidate() supported 4.8.5 refresh() supported 4.9 feature string for the hasfeature method call supported 5.
...And 4 more matches
Mozilla XForms User Interface - Archive of obsolete content
for example, a xforms input control may appear as a text field or as a datepicker depending on whether it is bound to a xsd:string type or a xsd:date type.
... when a xf:output binds to a node that has a type of xsd:date, we output the date value as plain text.
... an output bound to a date and also having @appearance='full' will display as a calendar.
...And 4 more matches
Implementing controls using the Gamepad API - Game development
the first one is fired when the browser detects the connection of a new gamepad while the second one is fired when a gamepad is disconnected (either physically by the user or due to inactivity.) in the demo, the gamepadapi object is used to store everything related to the api: var gamepadapi = { controller: {}, turbo: false, connect: function() {}, disconnect: function() {}, update: function() {}, buttonpressed: function() {}, buttons: [], buttonscache: [], buttonsstatus: [], axesstatus: [] }; the buttons array contains the xbox 360 button layout: buttons: [ 'dpad-up','dpad-down','dpad-left','dpad-right', 'start','back','axis-left','axis-right', 'lb','rb','power','a','b','x','y', ], this can be different for other types of gamepads like the ps3 controller...
... querying the gamepad object beside connect() and disconnect(), there are two more methods in the gamepadapi object: update() and buttonpressed().
... update() is executed on every frame inside the game loop, to update the actual status of the gamepad object regularly: update: function() { // clear the buttons cache gamepadapi.buttonscache = []; // move the buttons status from the previous frame to the cache for(var k=0; k<gamepadapi.buttonsstatus.length; k++) { gamepadapi.buttonscache[k] = gamepadapi.buttonsstatus[k]; } // clear the buttons status gamepadapi.buttonsstatus = []; // get the gamepad object var c = gamepadapi.controller || {}; // loop through buttons and push the pressed ones to the array var pressed = []; if(c.buttons) { for(var b=0,t=c.buttons.length; b<t; b++) { if(c.buttons[b].pressed) { pressed.push(gamepadapi.buttons[b]); } } } // loop through axes and push th...
...And 4 more matches
MVC - MDN Web Docs Glossary: Definitions of Web-related terms
if the state of this data changes, then the model will usually notify the view (so the display can change as needed) and sometimes the controller (if different logic is needed to control the updated view).
... the controller the controller contains logic that updates the model and/or view in response to input from the users of the app.
...these actions require the model to be updated, so the input is sent to the controller, which then manipulates the model as appropriate, which then sends updated data to the view.
...And 4 more matches
Client-side storage - Learn web development
our example will allow you enter a name, after which the page will update to give you a personalized greeting.
...in this function we remove the name item from web storage using removeitem(), then again run namedisplaycheck() to update the display.
...e let request = objectstore.add(newitem); request.onsuccess = function() { // clear the form, ready for adding the next entry titleinput.value = ''; bodyinput.value = ''; }; // report on the success of the transaction completing, when everything is done transaction.oncomplete = function() { console.log('transaction completed: database modification finished.'); // update the display of data to show the newly added item, by running displaydata() again.
...And 4 more matches
What is JavaScript? - Learn web development
a high-level definition javascript is a scripting or programming language that allows you to implement complex features on web pages — every time a web page does more than just sit there and display static information for you to look at — displaying timely content updates, interactive maps, animated 2d/3d graphics, scrolling video jukeboxes, etc.
...ign: center; border: 2px solid rgba(0,0,200,0.6); background: rgba(0,0,200,0.3); color: rgba(0,0,200,0.6); box-shadow: 1px 1px 2px rgba(0,0,200,0.4); border-radius: 10px; padding: 3px 10px; display: inline-block; cursor: pointer; } and finally, we can add some javascript to implement dynamic behaviour: const para = document.queryselector('p'); para.addeventlistener('click', updatename); function updatename() { let name = prompt('enter a new name'); para.textcontent = 'player 1: ' + name; } try clicking on this last version of the text label to see what happens (note also that you can find this demo on github — see the source code, or run it live)!
...we used a click event in our example above to detect when the button is clicked and then run the code that updates the text label.
...And 4 more matches
Getting started with Svelte - Learn web development
svelte will watch for file updates, and automatically recompile and refresh the app for you when changes are made to the source files.
... at this point you can try updating your app.svelte component — for example change the <h1> element on line 6 of app.svelte so that it reads like this: <h1>hello {name} from mdn!</h1> just save your changes and the app running at localhost:5000 will be automatically updated.
... a first look at svelte reactivity in the context of a ui framework, reactivity means that the framework can automatically update the dom when the state of any component is changed.
...And 4 more matches
Deploying our app - Learn web development
actually deploying the updated code to a live url: or potentially a staging url so it can be reviewed first.
...this unique filename "busts" your browser's cache, thereby making sure the browser downloads the fresh code each time an update is made to the deployed code.
...we can commit our code and push to github and the updated code will automatically trigger the entire build routine.
...And 4 more matches
Creating a spell check dictionary add-on
this page describes how to package a hunspell spell check dictionary as a firefox add-on, or how to update your existing add-on, so that it can be installed, uninstalled and updated without a restart.
...if there already is one, try contacting the author to get it updated, or contact amo editors if the author does not respond.
...if you update an existing dictionary add-on, you must keep the existing em:id, or your users will not be updated to the latest version.
...And 4 more matches
Updating NSPR or NSS in mozilla-central
(because some developers might not be aware that nspr/nss are separately maintained and released, the mozilla hg server rejects accidental changes/forking, if the required keywords are missing in the commit comment.) if nspr or nss must be upgraded to a new static tag, follow this procedure: before starting, make sure your local repository is updated to mozilla-central tip and that there are no local changes: $ hg status -mard pull the new sources $ python client.py update_nspr nspr_tag_name or $ python client.py update_nss nss_tag_name if you update a branch older than mozilla 17 (without the change from bug 782784), you must manually add a dummy change (add or remove a blank line) to force a rebuild of nspr: mozilla/nsprp...
...if merging is required, update the patch file.
... if a patch is no longer needed, remove the patch from the directory and update the readme file.
...And 4 more matches
Webapps.jsm
ebapps.jsm"); // exported symbol is domapplicationregistry method overview init: function() loadcurrentregistry: function() notifyappsregistrystart: function notifyappsregistrystart() notifyappsregistryready: function notifyappsregistryready() sanitizeredirects: function sanitizeredirects(asource) _savewidgetsfullpath: function(amanifest, adestapp) appkind: function(aapp, amanifest) updatepermissionsforapp: function(aid, aispreinstalled) updateofflinecacheforapp: function(aid) installpreinstalledapp: function installpreinstalledapp(aid) removeifhttpsduplicate: function(aid) installsystemapps: function() loadandupdateapps: function() updatedatastore: function(aid, aorigin, amanifesturl, amanifest) _registersystemmessagesforentrypoint: function(amanifest, aapp, aentrypoint) _...
...registerinterappconnectionsforentrypoint: function(amanifest, aapp,) _registersystemmessages: function(amanifest, aapp) _registerinterappconnections: function(amanifest, aapp) _createactivitiestoregister: function(amanifest, aapp, aentrypoint, arunupdate) _registeractivitiesforapps: function(aappstoregister, arunupdate) _registeractivities: function(amanifest, aapp, arunupdate) _createactivitiestounregister: function(amanifest, aapp, aentrypoint) _unregisteractivitiesforapps: function(aappstounregister) _unregisteractivities: function(amanifest, aapp) _processmanifestforids: function(aids, arunupdate) observe: function(asubject, atopic, adata) addmessagelistener: function(amsgnames, aapp, amm) removemessagelistener: function(amsgnames, amm) formatmessage: function(adata) receivem...
...essage: function(amessage) getappinfo: function getappinfo(aappid) broadcastmessage: function broadcastmessage(amsgname, acontent) registerupdatehandler: function(ahandler) unregisterupdatehandler: function(ahandler) notifyupdatehandlers: function(aapp, amanifest, azippath) _getappdir: function(aid) _writefile: function(apath, adata) dogetlist: function() doexport: function(amsg, amm) doimport: function(amsg, amm) doextractmanifest: function(amsg, amm) dolaunch: function (adata, amm) launch: function launch(amanifesturl, astartpoint, atimestamp, aonsuccess, aonfailure) close: function close(aapp) canceldownload: function canceldownload(amanifesturl, aerror) startofflinecachedownload: function(amanifest, aapp, aprofiledir, aisupdate) computemanifesthash: function(amanifest) up...
...And 4 more matches
XPCOM changes in Gecko 2.0
this article details those changes, and provides suggestions for how to update your code.
...documentation will be updated as time allows to remove references to interfaces being "frozen" or "unfrozen." component registration the way xpcom components are registered changed in gecko 2.
...all existing xpcom components will need to be updated to support this.
...And 4 more matches
nsICRLManager
inherits from: nsisupports last changed in gecko 1.7 method overview wstring computenextautoupdatetime(in nsicrlinfo info, in unsigned long autoupdatetype, in double noofdays); void deletecrl(in unsigned long crlindex); nsiarray getcrls(); void importcrl([array, size_is(length)] in octet data, in unsigned long length, in nsiuri uri, in unsigned long type, in boolean dosilentdownload, in wstring crlkey); void reschedulecrlautoupdate(); boolean updatecrlfromurl(in wstring url, in wstring key); constants constant value description type_autoupdate_time_based 1 type_autoupdate_freq_based 2 methods computenextautoupdatetime() wstring computenextautoupdatetime( ...
... in nsicrlinfo info, in unsigned long autoupdatetype, in double noofdays ); parameters info autoupdatetype noofdays return value deletecrl() delete the crl.
...void importcrl( [array, size_is(length)] in octet data, in unsigned long length, in nsiuri uri, in unsigned long type, in boolean dosilentdownload, in wstring crlkey ); parameters data length uri type dosilentdownload crlkey reschedulecrlautoupdate() this would reschedule the autoupdate of crls with auto update enable.
...And 4 more matches
nsIDOMSimpleGestureEvent
mozmagnifygestureupdate - generated periodically while the user is continuing the magnify ("pinch") gesture.
... the "delta" value represents the movement since the last mozmagnifygesturestart or mozmagnifygestureupdate event.
...if you only want to receive a single event when the magnify gesture is complete, you only need to hook this event and can safely ignore the mozmagnifygesturestart and the mozmagnifygestureupdate events.
...And 4 more matches
nsIDownloadManager
adddownload(in short adownloadtype, in nsiuri asource, in nsiuri atarget, in astring adisplayname, in nsimimeinfo amimeinfo, in prtime astarttime, in nsilocalfile atempfile, in nsicancelable acancelable, in boolean aisprivate); void addlistener(in nsidownloadprogresslistener alistener); void canceldownload(in unsigned long aid); void cleanup(); void endbatchupdate(); obsolete since gecko 1.9.1 void flush(); obsolete since gecko 1.8 nsidownload getdownload(in unsigned long aid); void onclose(); obsolete since gecko 1.9.1 void open(in nsidomwindow aparent, in nsidownload adownload); obsolete since gecko 1.9.1 void openprogressdialogfor(in nsidownload adownload, in nsidomwindow aparent, in boolean acanceldownloado...
...; void removedownload(in unsigned long aid); void removedownloadsbytimeframe(in long long abegintime, in long long aendtime); void removelistener(in nsidownloadprogresslistener alistener); void resumedownload(in unsigned long aid); void retrydownload(in unsigned long aid); void savestate(); obsolete since gecko 1.8 void startbatchupdate(); obsolete since gecko 1.9.1 attributes attribute type description activedownloadcount long the number of files currently being downloaded.
... endbatchupdate() obsolete since gecko 1.9.1 (firefox 3.5 / thunderbird 3.0 / seamonkey 2.0) indicate that a batch update is ending.
...And 4 more matches
nsIWindowMediator
void updatewindowtimestamp(in nsixulwindow awindow); native code only!
... void updatewindowtitle(in nsixulwindow awindow, in wstring intitle ); native code only!
...you may need to update your code or recompile binary components, if they use this method.
...And 4 more matches
RTCIceProtocol - Web APIs
the webrtc api's rtciceprotocol enumerated type provides a set of domstring values representing the names of the transport protocols ice candidates can use.
... these strings are taken directly from the candidate a-line in sdp.
... values tcp the candidate, if selected, would use tcp as the transport protocol for its data.
...And 4 more matches
RTCPeerConnection() - Web APIs
rtcconfiguration dictionary bundlepolicy optional specifies how to handle negotiation of candidates when the remote peer is not compatible with the sdp bundle standard.
... icecandidatepoolsize optional an unsigned 16-bit integer value which specifies the size of the prefetched ice candidate pool.
... the default value is 0 (meaning no candidate prefetching will occur).
...And 4 more matches
RTCPeerConnection: iceconnectionstatechange event - Web APIs
this can happen when only the last checked candidate is successful, and the gathering and end-of-candidates signals both occur before the successful negotiation is completed.
... state transitions as negotiation ends when the negotiation process runs out of candidates to check, the ice connection transitions to one of two states.
... if no suitable candidates were found, the state transitions to failed.
...And 4 more matches
Service Worker API - Web APIs
they are intended, among other things, to enable the creation of effective offline experiences, intercept network requests and take appropriate action based on whether the network is available, and update assets residing on the server.
... after that, it is updated when: a navigation to an in-scope page occurs.
... receiving centralized updates to expensive-to-calculate data such as geolocation or gyroscope, so multiple pages can make use of one set of data.
...And 4 more matches
SourceBuffer - Web APIs
sourcebuffer.updating read only a boolean indicating whether the sourcebuffer is currently being updated — i.e.
... sourcebuffer.onupdate fired whenever sourcebuffer.appendbuffer() method or the sourcebuffer.remove() completes.
...this event is fired before onupdateend.
...And 4 more matches
WebGL best practices - Web APIs
avoid invalidating fbo attachment bindings almost any change to an fbo's attachment bindings will invalidate its framebuffer completeness.
...for unchanged vaos, browsers can cache the fetch limits, whereas when vaos change, browsers must revalidate and recalculate limits.
...the cap also must typically be updated as the browser window resizes, and older resources above the limit must be purged.
...And 4 more matches
Using the Web Storage API - Web APIs
the landing page provides controls that can be used to customize the color, font, and decorative image: when you choose different options, the page is instantly updated; in addition, your choices are stored in localstorage, so that when you leave the page and load it again, later on, your choices are remembered.
... we have also provided an event output page — if you load this page in another tab, then make changes to your choices in the landing page, you'll see the updated storage information outputted as a storageevent is fired.
...if there are already values there, we run setstyles() to update the page styling with the stored values.
...And 4 more matches
ARIA - Accessibility
for example, aria enables accessible navigation landmarks in html4, javascript widgets, form hints and error messages, live content updates, and more.
...the aria-valuemin and aria-valuemax attributes specify the minimum and maximum values for the progress bar, and the aria-valuenow describes the current state of it and therefore must be kept updated with javascript.
... along with placing them directly in the markup, aria attributes can be added to the element and updated dynamically using javascript code like this: // find the progress bar <div> in the dom.
...And 4 more matches
Backwards Compatibility of Flexbox - CSS: Cascading Style Sheets
the history of flexbox as with all css specifications the flexbox specification went through a large number of changes before it became the candidate recommendation that we have today.
... as a candidate recommendation we should not see large changes at this point to the spec, however this has not been the case with past flexbox iterations.
...however, prefixes ultimately were used in production code, and changes to the experimental specification caused people to need to update their sites to keep up.
...And 4 more matches
<input type="file"> - HTML: Hypertext Markup Language
WebHTMLElementinputfile
lastmodified a number specifying the date and time at which the file was last modified, in milliseconds since the unix epoch (january 1, 1970 at midnight).
... lastmodifieddate a date object representing the date and time at which the file was last modified.
... the accept attribute doesn't validate the types of the selected files; it simply provides hints for browsers to guide users towards selecting the correct file types.
...And 4 more matches
Intl - JavaScript
the intl object is the namespace for the ecmascript internationalization api, which provides language sensitive string comparison, number formatting, and date and time formatting.
... intl.datetimeformat() constructor for objects that enable language-sensitive date and time formatting.
... this registry is periodically updated over time, and implementations may not always be up to date, so be careful not to rely too much on tags being universally supported.
...And 4 more matches
eval() - JavaScript
bad code with eval(): function loosejsonparse(obj){ return eval("(" + obj + ")"); } console.log(loosejsonparse( "{a:(4-1), b:function(){}, c:new date()}" )) better code without eval(): function loosejsonparse(obj){ return function('"use strict";return (' + obj + ')')(); } console.log(loosejsonparse( "{a:(4-1), b:function(){}, c:new date()}" )) comparing the two code snippets above, the two code snippets might seem to work the same way, but think again: the eval() one is a great deal slower.
... notice c: new date() in the evaluated object.
... in the function without the eval(), the object is being evaluated in the global scope, so it is safe for the browser to assume that date refers to window.date() instead of a local variable called date.
...And 4 more matches
Porting the Library Detector - Archive of obsolete content
it's a very simple add-on and a good candidate for porting because there are suitable sdk apis for all its features.
... finally, it listens to gbrowser's tabselect event, to update the contents of the box for that window.
...ry-detector.js')), onattach: function(worker) { worker.on('message', function(librarylist) { if (!worker.tab.libraries) { worker.tab.libraries = []; } librarylist.foreach(function(library) { if (worker.tab.libraries.indexof(library) == -1) { worker.tab.libraries.push(library); } }); if (worker.tab == tabs.activetab) { updatewidgetview(worker.tab); } }); } }); the content script is executed once for every window.onload event, so it will run multiple times when a single page containing multiple iframes is loaded.
...And 3 more matches
ui/button/action - Archive of obsolete content
this can be a number or a string, and you can update it at any time.
...a disabled button will not generate click events and its icon will appear disabled: updating state you can update all the button's properties except for its id.
... by default, the button has global state: that is, its properties are the same across all open windows and tabs, and updating them updates the button's state across all open windows and tabs.
...And 3 more matches
Installing Extensions and Themes From Web Pages - Archive of obsolete content
a note on updateenabled() installtrigger exposes a function called updateenabled that some of you may be calling before you call installtrigger.install.
... this is not necessary as install calls updateenabled itself internally.
... furthermore, calling updateenabled may lead to problems if your distribution site is not in the user's whitelist, because firefox only displays the "installation blocked" message when install or installchrome are called, or when a xpi file is loaded.
...And 3 more matches
Promises - Archive of obsolete content
let info = yield os.file.stat(configpath); if (info.lastmodificationdate <= timestamp) return; timestamp = info.lastmodificationdate; // read the file as a utf-8 string, parse as json.
... config.indexstats = processor.stats; yield os.file.writeatomic(configpath, json.stringify(config), { tmppath: configpath + "." + math.random(), encoding: "utf-8" }) timestamp = new date; }); http requests http requests should, in nearly all circumstances, be made via the standard xmlhttprequest api.
... resp = yield new promise((resolve, reject) => { let xhr = new xmlhttprequest; xhr.onload = resolve; xhr.onerror = reject; xhr.open("post", updateurl); xhr.send(form); }); // use the response of the second request.
...And 3 more matches
Adding preferences to an extension - Archive of obsolete content
get the code here: download the sample update the manifests the install manifest and chrome manifest need to be updated.
...its job is to start up the observer to watch for changes to our preferences, instantiate an object to use to manage our preferences, and install an interval routine to update the stock information periodically.
... if the changed preference is "symbol", we grab the updated value of the preference by calling the nsiprefbranch.getcharpref() method, and stash it in our tickersymbol variable.
...And 3 more matches
Source code directories overview - Archive of obsolete content
it is a living document which is (supposed to be) updated monthly according to changes in the mozilla source tree.
...it has not been updated to support xpcom yet.
...the format of the date and time for different cultures) and other localization facilities.
...And 3 more matches
jspage - Archive of obsolete content
rn d;};native.genericize=function(b,c,a){if((!a||!b[c])&&typeof b.prototype[c]=="function"){b[c]=function(){var d=array.prototype.slice.call(arguments); return b.prototype[c].apply(d.shift(),d);};}};native.implement=function(d,c){for(var b=0,a=d.length;b<a;b++){d[b].implement(c);}};native.typize=function(a,b){if(!a.type){a.type=function(c){return($type(c)===b); };}};(function(){var a={array:array,date:date,function:function,number:number,regexp:regexp,string:string};for(var h in a){new native({name:h,initialize:a[h],protect:true}); }var d={"boolean":boolean,"native":native,object:object};for(var c in d){native.typize(d[c],c);}var f={array:["concat","indexof","join","lastindexof","pop","push","reverse","shift","slice","sort","splice","tostring","unshift","valueof"],string:["charat","charcodeat"...
...or(var c in b){var g=b[c],f=e[c];e[c]=(f&&$type(g)=="object"&&$type(f)=="object")?$mixin(f,g):$unlink(g);}}return e;}function $pick(){for(var b=0,a=arguments.length; b<a;b++){if(arguments[b]!=undefined){return arguments[b];}}return null;}function $random(b,a){return math.floor(math.random()*(a-b+1)+b);}function $splat(b){var a=$type(b); return(a)?((a!="array"&&a!="arguments")?[b]:b):[];}var $time=date.now||function(){return +new date;};function $try(){for(var b=0,a=arguments.length;b<a; b++){try{return arguments[b]();}catch(c){}}return null;}function $type(a){if(a==undefined){return false;}if(a.$family){return(a.$family.name=="number"&&!isfinite(a))?false:a.$family.name; }if(a.nodename){switch(a.nodetype){case 1:return"element";case 3:return(/\s/).test(a.nodevalue)?"textnode":"whitespace";}}el...
...eturn json.encode(this);}});var cookie=new class({implements:options,options:{path:false,domain:false,duration:false,secure:false,document:document},initialize:function(b,a){this.key=b; this.setoptions(a);},write:function(b){b=encodeuricomponent(b);if(this.options.domain){b+="; domain="+this.options.domain;}if(this.options.path){b+="; path="+this.options.path; }if(this.options.duration){var a=new date();a.settime(a.gettime()+this.options.duration*24*60*60*1000);b+="; expires="+a.togmtstring();}if(this.options.secure){b+="; secure"; }this.options.document.cookie=this.key+"="+b;return this;},read:function(){var a=this.options.document.cookie.match("(?:^|;)\\s*"+this.key.escaperegexp()+"=([^;]*)"); return(a)?decodeuricomponent(a[1]):null;},dispose:function(){new cookie(this.key,$merge(this.option...
...And 3 more matches
RDF Datasource How-To - Archive of obsolete content
this article is at least partially outdated.
... help bring it up to date, if you can.
... the xpcom registration parts and the "as of this writing, it is not currently possible to implement javascript xpcom components" comment seem outdated didn't check the whole article.
...And 3 more matches
RDF Datasources - Archive of obsolete content
date http://home.netscape.com/nc-rdf#date date of last visit name http://home.netscape.com/nc-rdf#name title of the page page http://home.netscape.com/nc-rdf#page page name referrer http://home.netscape.com/nc-rdf#referrer referrer of the page url http://home.netscape.com/nc-rdf#url ...
...you can also use the value nc:historybydate to get the history sorted into days.
...we'll display the history in a tree with three columns, the name, the url and the date.
...And 3 more matches
Trees and Templates - Archive of obsolete content
the following example uses the history datasource: <tree datasources="rdf:history" ref="nc:historybydate" flags="dont-build-content"> as described in the previous section, the tree may use a tree builder for template generation instead of the normal content builder.
...example 1 : source <tree id="my-tree" flex="1" datasources="rdf:files" ref="nc:filesroot" flags="dont-build-content"> <treecols> <treecol id="name" label="name" primary="true" flex="1"/> <splitter/> <treecol id="date" label="date" flex="1"/> </treecols> <template> <rule> <treechildren> <treeitem uri="rdf:*"> <treerow> <treecell label="rdf:http://home.netscape.com/nc-rdf#name"/> <treecell label="rdf:http://home.netscape.com/web-rdf#lastmodifieddate"/> </treerow> </treeitem> </treechildren> </rule> </t...
...emplate> </tree> here, a tree is created with two columns, for the name and date of a file.
...And 3 more matches
XForms Select1 Element - Archive of obsolete content
xhtml widget characteristics analogous widgets is <html:select/> visual grouping by choices element is supported selection="open" is supported if incremental attribute value is false, the bound node is updated when the select1 control is blurred (i.e.
... loses focus), otherwise it is updated upon item selection xul widget characteristics analogous widgets are <html:select/> and <xul:menulist/> visual grouping by choices element isn't implemented selection="open" attribute isn't supported if incremental attribute value is false, the bound node is updated when the select control is blurred (i.e.
... loses focus), otherwise it is updated upon item selection listbox the select1 is represented as listbox (xhtml/xul).
...And 3 more matches
Images in HTML - Learn web development
.a11y-label { margin: 0; text-align: right; font-size: 0.7rem; width: 98%; } body { margin: 10px; background: #f5f9fa; } var textarea = document.getelementbyid('code'); var reset = document.getelementbyid('reset'); var solution = document.getelementbyid('solution'); var output = document.queryselector('.output'); var code = textarea.value; var userentry = textarea.value; function updatecode() { output.innerhtml = textarea.value; } reset.addeventlistener('click', function() { textarea.value = code; userentry = textarea.value; solutionentry = htmlsolution; solution.value = 'show solution'; updatecode(); }); solution.addeventlistener('click', function() { if(solution.value === 'show solution') { textarea.value = solutionentry; solution.value = 'hide solution...
...'; } else { textarea.value = userentry; solution.value = 'show solution'; } updatecode(); }); var htmlsolution = '<img src="https://udn.realityripple.com/samples/ec/5a13bd14f6.jpg"\n alt="the head and torso of a dinosaur skeleton; it has a large head with long sharp teeth"\n width="200"\n height="171"\n title="a t-rex on display in the manchester university museum">'; var solutionentry = htmlsolution; textarea.addeventlistener('input', updatecode); window.addeventlistener('load', updatecode); // stop tab key tabbing out of textarea and // make it write a tab at the caret position instead textarea.onkeydown = function(e){ if (e.keycode === 9) { e.preventdefault(); insertatcaret('\t'); } if (e.keycode === 27) { textarea.blur(); } }; function insertatcaret(...
...; var caretpos = textarea.selectionstart; var front = (textarea.value).substring(0, caretpos); var back = (textarea.value).substring(textarea.selectionend, textarea.value.length); textarea.value = front + text + back; caretpos = caretpos + text.length; textarea.selectionstart = caretpos; textarea.selectionend = caretpos; textarea.focus(); textarea.scrolltop = scrollpos; } // update the saved usercode every time the user updates the text area code textarea.onkeyup = function(){ // we only want to save the state when the user code is being shown, // not the solution, so that solution is not saved over the user code if(solution.value === 'show solution') { userentry = textarea.value; } else { solutionentry = textarea.value; } updatecode(); }; annotati...
...And 3 more matches
General asynchronous programming concepts - Learn web development
in our simple-sync.html example (see it running live), we add a click event listener to a button so that when clicked, it runs a time-consuming operation (calculates 10 million dates then logs the final one to the console) and then adds a paragraph to the dom: const btn = document.queryselector('button'); btn.addeventlistener('click', () => { let mydate; for(let i = 0; i < 10000000; i++) { let date = new date(); mydate = date } console.log(mydate); let pelem = document.createelement('p'); pelem.textcontent = 'this is a newly-added paragraph.'; docume...
...nt.body.appendchild(pelem); }); when running the example, open your javascript console then click the button — you'll notice that the paragraph does not appear until after the dates have finished being calculated and the console message has been logged.
...you would never calculate 10 million dates on a real web app!
...And 3 more matches
Third-party APIs - Learn web development
the app will end up allowing you to type in a search term and optional start and end dates, which it will then use to query the article search api and display the search results.
...and fetchresults() function definitions, below the previous line: function submitsearch(e) { pagenumber = 0; fetchresults(e); } function fetchresults(e) { // use preventdefault() to stop the form submitting e.preventdefault(); // assemble the full url url = baseurl + '?api-key=' + key + '&page=' + pagenumber + '&q=' + searchterm.value + '&fq=document_type:("article")'; if(startdate.value !== '') { url += '&begin_date=' + startdate.value; }; if(enddate.value !== '') { url += '&end_date=' + enddate.value; }; } submitsearch() sets the page number back to 0 to begin with, then calls fetchresults().
... next, we use a couple of if() statements to check whether the startdate and enddate <input>s have had values filled in on them.
...And 3 more matches
Object building practice - Learn web development
updating the ball's data we can draw the ball in position, but to actually move the ball, we need an update function of some kind.
... add the following code at the bottom of your javascript file, to add an update() method to the ball()'s prototype: ball.prototype.update = function() { if ((this.x + this.size) >= width) { this.velx = -(this.velx); } if ((this.x - this.size) <= 0) { this.velx = -(this.velx); } if ((this.y + this.size) >= height) { this.vely = -(this.vely); } if ((this.y - this.size) <= 0) { this.vely = -(this.vely); } this.x += this.velx; this.y += this.vely; } the first four parts of the function check whether the ball has reached the edge of the canvas.
... add the following to the bottom of your code now: function loop() { ctx.fillstyle = 'rgba(0, 0, 0, 0.25)'; ctx.fillrect(0, 0, width, height); for (let i = 0; i < balls.length; i++) { balls[i].draw(); balls[i].update(); } requestanimationframe(loop); } all programs that animate things generally involve an animation loop, which serves to update the information in the program and then render the resulting view on each frame of the animation; this is the basis for most games and other such programs.
...And 3 more matches
Ember interactivity: Events, classes and state - Learn web development
update the content to the following: import component from '@glimmer/component'; import { action } from '@ember/object'; export default class headercomponent extends component { @action onkeydown({ target, key }) { let text = target.value.trim(); let hasvalue = boolean(text); if (key === 'enter' && hasvalue) { alert(text); target.value = '' } } } the @action decor...
...for example, the @tracked decorator (see slightly later on) runs code it is applied to, but additionally tracks it and automatically updates the app when values change.
...the only ember-specific part of this class is the @tracked decorator — this hooks in to the reactivity system and allows ember to update what you're seeing in your app automatically if the tracked properties change.
...And 3 more matches
Using Vue computed properties - Learn web development
add the described <h2> and update the <ul> inside your app's template as follows: <h2 id="list-summary">{{listsummary}}</h2> <ul aria-labelledby="list-summary" class="stack-large"> <li v-for="item in todoitems" :key="item.id"> <to-do-item :label="item.label" :done="item.done" :id="item.id"></to-do-item> </li> </ul> you should now see the list summary in your app, and the total number of items update as you add more todo...
... tracking changes to "done" we can use events to capture the checkbox update and manage our list accordingly.
... update the <input> element in todoitem.vue to look like this.
...And 3 more matches
Creating reftest-based unit tests
another part is testing invalidation - testing that when a document is changed after it has finished loading and displaying, that the browser correctly "invalidates" the parts of the screen that should change so that the screen displays the correct output the next time it is repainted.
... invalidation tests check both that the internal state of the document has been updated correctly, and that the browser then correctly invalidates and repaints the appropriate parts of the screen.
...next you need to add a listener for the 'mozreftestinvalidate' event, and only make the changes you want to test invalidation for after that event has fired.
...And 3 more matches
Displaying Places information using views
when a view's underlying data changes, the view will automatically update itself so that it displays the new data.
... this update is handled by logic between the view and its results.
... the following table shows the mappings between these magic column id values and their corresponding nsinavhistoryresultnode properties: treecol id or anonid corresponding nsinavhistoryresultnode property title title url uri date time visitcount accesscount keyword * description * dateadded dateadded lastmodified lastmodified tags tags ** icon *keyword and description are looked up in the places database using the nsinavhistoryresultnode property itemid.
...And 3 more matches
Localizing with Koala
owing commands: c:\users\stas> cd c:\mozilla\l10n\application\firefox c:\mozilla\l10n\application\firefox> rmdir 3.6 c:\mozilla\l10n\application\firefox> hg clone http://hg.mozilla.org/releases/mozilla-1.9.2 3.6 requesting all changes adding changesets adding manifests adding file changes added 33099 changesets with 158636 changes to 50664 files (+9 heads) updating working directory 40357 files updated, 0 files merged, 0 files removed, 0 files unresolved configure the locale locale id: x-testing (put your locale's code) version: 3.6 location: choose the folder where you want to keep the localized files or leave empty for now check "mercurial" if you wish to use mercurial to keep the revision history of your files (very recommended) existing localizations: url: if you're editing an existi...
...to make sure you're always translating the most recent en-us reference, you should update the source repository before you start working.
...in "last used compares" click "update repo" to update the en-us repository to the most recent version.
...And 3 more matches
Localizing with Mercurial
if the utility modified your %path% successfully, a dialog will open saying, "%path% has been updated correctly." alternatively, you can edit the %path% variable manually.
...for example, to clone your firefox nightly l10n repo, run the following command, replacing ab-cd with your locale code: hg clone https://hg.mozilla.org/l10n-central/ab-cd/ updating your local repos to update your working copy of mozilla-central, go to your local mozilla-central directory and run: hg pull -u this will both get new changesets from mozilla-central and apply those changes in your working copy.
... to update your working copy of comm-central, go to your comm-central directory and run: python client.py checkout this will both get new changesets from comm-central, mozilla-central and the other appropriate locations and apply those changes in your working copy.
...And 3 more matches
Localizing with Mozilla Translator
getting started with mozillatranslator mt uses products as groups of localization files with a common root directory (for instance, you may have a product for thunderbird, other for seamonkey, other for dom, other for toolkit, etc.) you update your repository copy using your favorite repository tool, and then update the product(s) in mt.
... this will remove obsolete strings and files from the internal database of mt, and will present you with a list of new and updated strings.
... if you are starting a new localization, all strings will be marked as new or updated.mt puts a fuzzy flag on each flag and saves it in its database.
...And 3 more matches
Localization formats
how often, if at all, the site will be updated after the launch?
... is this a long-term project with continuous updates to content?
... html/php maybe you are designing a project that has relatively small translation needs like three to four lines (or more) of content asking users to update to the next version of software available.
...And 3 more matches
NSS 3.35 release notes
nss 3.35 source distributions are available on ftp.mozilla.org for secure https download: source tarballs: https://ftp.mozilla.org/pub/mozilla.org/security/nss/releases/nss_3_35_rtm/src/ new in nss 3.35 new functionality tls 1.3 support has been updated to draft -23.
...cn = chambers of commerce root sha-256 fingerprint: 0c:25:8a:12:a5:67:4a:ef:25:f2:8b:a7:dc:fa:ec:ee:a3:48:e5:41:e6:f5:cc:4e:e6:3b:71:b3:61:60:6a:c3 cn = global chambersign root sha-256 fingerprint: ef:3c:b4:17:fc:8e:bf:6f:97:87:6c:9e:4e:ce:39:de:1e:a5:fe:64:91:41:d1:02:8b:7d:11:c0:b2:29:8c:ed significant changes to tls 1.3 were made, along with the update from draft -18 to draft -23: support for keyupdate was added.
... keyupdate will be used automatically, if a cipher is used for a sufficient number of records.
...And 3 more matches
NSS 3.52 release notes
notable changes in nss 3.52 bug 1603628 - update nss to support pkcs #11 v3.0.
... bug 1626751 - fix error in generation of fuzz32 docker image after updates.
... bug 1619056 - update readme: tls 1.3 is not experimental anymore.
...And 3 more matches
Notes on TLS - SSL 3.0 Intolerant Servers
for up-to-date information, you can read a bugzilla bug report which keeps track of this problem with mozilla-based browsers.
...) domino-go-webserver/4.6.2.6 (and perhaps some later versions) ibm_http_server/1.3.6.3 or earlier (* update to 1.3.6.4) ibm_http_server/1.3.12.1 or earlier (* update to 1.3.12.2) java web server 2 osu/3.2 - decthreads http server for openvm stronghold/2.2 webmail v.
... 3.6.1 by infinite technologies (* update available) n.b.
...And 3 more matches
GCIntegration - SpiderMonkey Redirect 1
every time a pointer is updated, a small amount of code runs that may mark one of the objects involved in the update.
...any time a property is updated in the vm or the jit, a write barrier is invoked.
...for example, the following code will be incorrect: autorootedobject obj1 = ...; jsobject *obj2 = obj1; // use obj2 if a gc runs in the middle of this code, and if obj1/obj2 is moved, then the obj1 pointer will be updated to point to the new location.
...And 3 more matches
Hacking Tips
$ valgrind --smc-check=all-non-file --vex-iropt-register-updates=allregs-at-mem-access --vgdb-error=0 ./js … this command will tell you how to start gdb as a remote.
...(2 locations) (gdb) dprintf ion.cpp:3196, "invalidate %s:%d:%d-%d\n", co->script_->scriptsource()->filename_.mtuple.mfirsta, co->script_->lineno_, co->script_->sourcestart_, co->script_->sourceend_ dprintf 3 at 0x7fb4f6a0b62a: file /home/nicolas/mozilla/contrib-push/js/src/jit/ion.cpp, line 3196.
... (gdb) continue compiling self-hosted:650:20470-21501 bailout from self-hosted:20:403-500 invalidate self-hosted:20:403-500 note: the line 3196, listed above, corresponds to the location of the jit spew inside jit::invalidate function.
...And 3 more matches
SpiderMonkey 1.8.5
note that version 1.8.5 is outdated.
...embeddings that defined jsnatives in previous versions must update all those functions to the new signature.
... the type of setters has changed from jspropertyop to jsstrictpropertyop (to accomodate es5 strict mode).
...And 3 more matches
Mozilla Projects
mccoy is an application that allows add-on authors to provide secure updates to their users.
... applications periodically look for and install updates to their add-ons.
... it's important that the update information retrieved has not been tampered with since being written by the add-on author.
...And 3 more matches
History Service Design
the user can query his visits based on a date range, meta contents or revisit behavior.
...old history system was instead only storing first and last visit date, and a generic visits counter, creating some problem due to the impossibility to represent real history flow in a timeframe.
...for example, is possible to create a query folder containing the 10 pages most visited by the user, allowing to fast find good candidates for bookmarking.
...And 3 more matches
Querying Places
the visit date for each node will be the last visit date for that url.
...the result may contain duplicate entries for urls, each with a different date.
...te unsigned long foldercount basic query configuration options const unsigned short group_by_day = 0 const unsigned short group_by_host = 1 const unsigned short group_by_domain = 2 const unsigned short group_by_folder = 3 const unsigned short sort_by_none = 0 const unsigned short sort_by_title_ascending = 1 const unsigned short sort_by_title_descending = 2 const unsigned short sort_by_date_ascending = 3 const unsigned short sort_by_date_descending = 4 const unsigned short sort_by_uri_ascending = 5 const unsigned short sort_by_uri_descending = 6 const unsigned short sort_by_visitcount_ascending = 7 const unsigned short sort_by_visitcount_descending = 8 const unsigned short sort_by_keyword_ascending = 9 const unsigned short sort_by_keyword_descending = 10 const unsigned short...
...And 3 more matches
Using the Places history service
this entry contained the url, title, visit count, last visit date, first visit date, host name, last referrer, flags for typed, hidden, and gecko flags (gecko flags is trunk only).
...a visit contains a reference to the url table for the page, the visit date, the transition type (typed, click, redirect, bookmark, etc.), a reference to the referring visit, and the session id.
... nsinavhistoryservice.beginupdatebatch: call when you will be making many small changes to the history system.
...And 3 more matches
nsIAccessibleTreeCache
last changed in gecko 1.9.1 (firefox 3.5 / thunderbird 3.0 / seamonkey 2.0) inherits from: nsisupports method overview nsiaccessible getcachedtreeitemaccessible(in long arow, in nsitreecolumn acolumn); void invalidatecache(in long arow, in long acount); void treeviewchanged(); void treeviewinvalidated(in long astartrow, in long aendrow, in long astartcol, in long aendcol); methods getcachedtreeitemaccessible() returns the tree item from the cache for the cell in the specified row and column; the nsiaccessible is created if it doesn't already exist in the cache.
...invalidatecache() invalidates the number of cached treeitem accessibles.
... void invalidatecache( in long arow, in long acount ); parameters arow row index the invalidation starts from.
...And 3 more matches
nsICache
access_read_write 3 access requested - i want to read, but i'm willing to update an existing entry if necessary, or create a new one if none exists.
...if a cache entry is waiting to be validated by another cache descriptor (so no new cache descriptors for that key can be created), opencacheentry() will return ns_error_cache_wait_for_validation in non-blocking mode.
... if the cache entry is validated, then a descriptor for that entry will be created and returned.
...And 3 more matches
nsIMsgDBView
ordervalue sortorder, in nsmsgviewflagstypevalue viewflags, out long count); void openwithhdrs(in nsisimpleenumerator aheaders, in nsmsgviewsorttypevalue asorttype, in nsmsgviewsortordervalue asortorder, in nsmsgviewflagstypevalue aviewflags, out long acount); void close(); void init(in nsimessenger amessengerinstance, in nsimsgwindow amsgwindow, in nsimsgdbviewcommandupdater acommandupdater); void sort(in nsmsgviewsorttypevalue sorttype, in nsmsgviewsortordervalue sortorder); void docommand(in nsmsgviewcommandtypevalue command); void docommandwithfolder(in nsmsgviewcommandtypevalue command, in nsimsgfolder destfolder); void getcommandstatus(in nsmsgviewcommandtypevalue command, out boolean selectable_p, out nsmsgviewcommandcheckst...
...smsgnavigationtypevalue motion); nsmsgkey getkeyat(in nsmsgviewindex index); nsimsgdbhdr getmsghdrat(in nsmsgviewindex index); nsimsgfolder getfolderforviewindex(in nsmsgviewindex index); acstring geturiforviewindex(in nsmsgviewindex index); nsimsgdbview clonedbview(in nsimessenger amessengerinstance, in nsimsgwindow amsgwindow, in nsimsgdbviewcommandupdater acommandupdater); void geturisforselection([array, size_is(count)] out string uris, out unsigned long count); void getindicesforselection([array, size_is(count)] out nsmsgviewindex indices, out unsigned long count); void loadmessagebymsgkey(in nsmsgkey amsgkey); void loadmessagebyviewindex(in nsmsgviewindex aindex); void loadmessagebyurl(in string aur...
...author, date, status, etc).
...And 3 more matches
nsIMsgFolder
this page is out of date.
... inherits from: nsisupports method overview void startfolderloading(); void endfolderloading(); void updatefolder(in nsimsgwindow awindow); nsimsgfilterlist getfilterlist(in nsimsgwindow msgwindow); void setfilterlist(in nsimsgfilterlist filterlist); void forcedbclosed(); void delete(); void deletesubfolders(in nsisupportsarray folders, in nsimsgwindow msgwindow); void propagatedelete(in nsimsgfolder folder, in boolean deletestorage,in nsimsgwindow msgwindow); void recursivedelete(in boolean deletestorage, in nsimsgwindow msgwindow); void createsubfolder...
...w amsgwindow,in nsisupportsarray aofflinefolderarray); void emptytrash(in nsimsgwindow amsgwindow, in nsiurllistener alistener); void rename(in astring name, in nsimsgwindow msgwindow); void renamesubfolders( in nsimsgwindow msgwindow, in nsimsgfolder oldfolder); astring generateuniquesubfoldername(in astring prefix,in nsimsgfolder otherfolder); void updatesummarytotals(in boolean force); void summarychanged(); long getnumunread(in boolean deep); long gettotalmessages(in boolean deep); void clearnewmessages(); void clearrequirescleanup(); void setflag(in unsigned long flag); void clearflag(in unsigned long flag); boolean getflag(in unsigned long flag); void toggleflag(i...
...And 3 more matches
nsIRequest
by default, cached content is automatically validated if necessary before reuse.
... note: these flags are intended for normal browsing, and they should therefore not apply to content that must be validated before each use.
...according to rfc2616, this response must be validated before it can be taken from a cache.
...And 3 more matches
nsISelectionPrivate
inherits from: nsisupports last changed in gecko 35 (firefox 35 / thunderbird 35 / seamonkey 2.32) warning: the content of this article may be out of date.
... this page wasn't updated since the initial import in 2011.
... see the idl file linked above for up-to-date information.
...And 3 more matches
Index
the thunderbird team can update this content via the website at any time.
... 79 building a thunderbird extension 6: adding javascript in this step we will create a small piece of javascript code that inserts the current date into our statusbar widget.
...in addition mozilla update allows users to comment and provide feedback on your extension.
...And 3 more matches
WebIDL bindings
webidl type argument type return type dictionary/member type any js::handle<js::value> js::mutablehandle<js::value> js::value boolean bool bool bool byte int8_t int8_t int8_t bytestring const nsacstring& nscstring& (outparam) nsacstring& (outparam) nscstring date mozilla::dom::date domstring const nsastring& mozilla::dom::domstring& (outparam) nsastring& (outparam) nsstring& (outparam) nsstring utf8string const nsacstring& nsacstring& (outparam) nscstring double double double double float float float float interface: non-nullable foo& already_addrefed...
... date webidl date types are represented by a mozilla::dom::date struct.
...this allows the binding code to change the exact definition (e.g., to use auto arrays of different sizes and so forth) without having to update all the callees.
...And 3 more matches
Waterfall - Firefox Developer Tools
rendering waterfall one pattern that you'll often see in the waterfall view is something like this: this is a visualization of the basic algorithm the browser uses to update the page in response to some event: javascript function call: some event - for example, a dom event - causes some javascript in the page to run.
... this sequence needs to fit into a single frame, since the screen isn't updated until it is complete.
... importantly for responsiveness, the browser doesn't always have to go through every step: css animations update the page without having to run any javascript.
...And 3 more matches
Validators - Firefox Developer Tools
this document lists different resources for developers to validate web pages.
... w3c html validator the w3c html validator will validate any web page according to the w3c html standards.
... w3c css validator the w3c css validator will validate the css within any web page or external css files according to the w3c css standards.
...And 3 more matches
Basic animations - Web APIs
scheduled updates first there's the window.setinterval(), window.settimeout(), and window.requestanimationframe() functions, which can be used to call a specific function over a set period of time.
... requestanimationframe(callback) tells the browser that you wish to perform an animation and requests that the browser call a specified function to update an animation before the next repaint.
...nvas_earth.png'; window.requestanimationframe(draw); } function draw() { var ctx = document.getelementbyid('canvas').getcontext('2d'); ctx.globalcompositeoperation = 'destination-over'; ctx.clearrect(0, 0, 300, 300); // clear canvas ctx.fillstyle = 'rgba(0, 0, 0, 0.4)'; ctx.strokestyle = 'rgba(0, 153, 255, 0.4)'; ctx.save(); ctx.translate(150, 150); // earth var time = new date(); ctx.rotate(((2 * math.pi) / 60) * time.getseconds() + ((2 * math.pi) / 60000) * time.getmilliseconds()); ctx.translate(105, 0); ctx.fillrect(0, -12, 40, 24); // shadow ctx.drawimage(earth, -12, -12); // moon ctx.save(); ctx.rotate(((2 * math.pi) / 6) * time.getseconds() + ((2 * math.pi) / 6000) * time.getmilliseconds()); ctx.translate(0, 28.5); ctx.drawimage(moon, -3.5, -3.5...
...And 3 more matches
Document.cookie - Web APIs
WebAPIDocumentcookie
note that each key and value may be surrounded by whitespace (space and tab characters): in fact, rfc 6265 mandates a single space after each semicolon, but some user agents may not abide by this.
...note that you can only set/update a single cookie at a time using this method.
... consider also that: any of the following cookie attribute values can optionally follow the key-value pair, specifying the cookie to set/update, and preceded by a semi-colon separator: ;path=path (e.g., '/', '/mydir') if not specified, defaults to the current path of the current document location.
...And 3 more matches
Document.lastModified - Web APIs
the lastmodified property of the document interface returns a string containing the date and time on which the current document was last modified.
... alert(document.lastmodified); // returns: tuesday, december 16, 2017 11:09:42 transforming lastmodified into a date object this example transforms lastmodified into a date object.
... let olastmodif = new date(document.lastmodified); transforming lastmodified into milliseconds this example transforms lastmodified into the number of milliseconds since january 1, 1970, 00:00:00, local time.
...And 3 more matches
Using the Gamepad API - Web APIs
timestamp: this returns a domhighrestimestamp representing the last time the data for this gamepad was updated, allowing developers to determine if the axes and button data have been updated from the hardware.
...values are monotonically increasing, meaning that they can be compared to determine the ordering of updates, as newer values will always be greater than or equal to older values.
...behind the scenes, this object will be updated every time the gamepad's state changes.
...And 3 more matches
HTMLFieldSetElement - Web APIs
this is the empty string if the element is not a candidate for constraint validation (willvalidate is false), or it satisfies its constraints.
... htmlfieldsetelement.willvalidate a boolean false, because <fieldset> objects are never candidates for constraint validation.
... htmlfieldsetelement.checkvalidity() always returns true because <fieldset> objects are never candidates for constraint validation.
...And 3 more matches
HTMLTextAreaElement - Web APIs
this is the empty string if the control is not a candidate for constraint validation (willvalidate is false), or it satisfies its constraints.
... willvalidate read only boolean: returns whether the element is a candidate for constraint validation.
... checkvalidity() returns false if the element is a candidate for constraint validation, and it does not satisfy its constraints.
...And 3 more matches
Basic concepts - Web APIs
the only place where the schema of the database can be updated is inside the handler of that event.
... note: this definition describes the most recent specification, which is only implemented in up-to-date browsers.
...the records in an index are automatically populated whenever records in the referenced object store are inserted, updated, or deleted.
...And 3 more matches
Online and offline events - Web APIs
this property is updated whenever the user switches into "offline mode" by selecting the corresponding menu item (file -> work offline in firefox).
... additionally, this property should update whenever a browser is no longer capable of connecting to the network.
... firefox 2 updates this property when switching to/from the browser's offline mode.
...And 3 more matches
Payment Request API - Web APIs
paymentrequestupdateevent enables the web page to update the details of the payment request in response to a user action.
... merchantvalidationevent represents the browser requiring the merchant (website) to validate themselves as allowed to use a particular payment handler (e.g., registered as allowed to use apple pay).
... paymentdetailsupdate an object describing changes that need to be made to the payment details in the event that the server needs to update information following the instantiation of the payment interface but before the user begins to interact with it.
...And 3 more matches
Multi-touch interaction - Web APIs
see the update_background function for more details about the color changes.
... // save this event for later processing (this could be part of a // multi-touch interaction) and update the background color push_event(ev); if (logevents) log("pointerdown: name = " + ev.target.id, ev); update_background(ev); } pointer move the pointermove handler is called when the pointer moves.
... if (logevents) log("pointermove", ev); update_background(ev); ev.target.style.border = "dashed"; } pointer up the pointerup event is fired when a pointer is raised from the contact surface.
...And 3 more matches
RTCPeerConnectionIceEvent() - Web APIs
syntax var event = new rtcpeerconnectioniceevent(type, options); parameters type is a domstring containing the name of the event, like "icecandidate".
... options a dictionary of type rtcpeerconnectioninit, which may contain one or more of the following fields: "candidate" (optional, default is null): a rtcicecandidate representing the ice candidate being concerned by the event.
... if null, the event indicates the end of candidate gathering.
...And 3 more matches
RTCPeerConnectionIceEvent - Web APIs
the rtcpeerconnectioniceevent interface represents events that occurs in relation to ice candidates with the target, usually an rtcpeerconnection.
... only one event is of this type: icecandidate.
... rtcpeerconnectioniceevent.candidate read only contains the rtcicecandidate containing the candidate associated with the event, or null if this event indicates that there are no further candidates to come.
...And 3 more matches
RTCStatsReport - Web APIs
the statistic category names are members of the enumerated type rtcstatstype, as follows: candidate-pair an rtcicecandidatepairstats object providing statistics related to an rtcicetransport.
... candidate pairs other than the currently active pair for the transport are deleted when the rtcpeerconnection changes its rtcpeerconnection.icegatheringstate to new during an ice restart.
... the active candidate pair is deleted after the transport switches to another candidate pair; this change cannot be detected otherwise.
...And 3 more matches
RTCStatsType - Web APIs
values candidate-pair an rtcicecandidatepairstats object providing statistics related to an rtcicetransport.
... candidate pairs other than the currently active pair for the transport are deleted when the rtcpeerconnection changes its rtcpeerconnection.icegatheringstate to new during an ice restart.
... the active candidate pair is deleted after the transport switches to another candidate pair; this change cannot be detected otherwise.
...And 3 more matches
Basic scissoring - Web APIs
although the clear() drawing command writes the clear color (set by clearcolor()) to all pixels in the drawing buffer, scissor() defines a mask that only allows pixels inside the specified rectangular area to be updated.
...in other cases, the fragments may be discarded altogether (so the pixel value is not updated), or it may interact with the already existing pixel value (such as when doing color blending for non-opaque elements in the scene).
...before the actual pixels are updated, fragments must go through the scissor test.
...And 3 more matches
Animating textures in WebGL - Web APIs
getting access to the video the first step is to create the <video> element that we'll use to retrieve the video frames: // will set to true when video can be copied to texture var copyvideo = false; function setupvideo(url) { const video = document.createelement('video'); var playing = false; var timeupdate = false; video.autoplay = true; video.muted = true; video.loop = true; // waiting for these 2 events ensures // there is data in the video video.addeventlistener('playing', function() { playing = true; checkready(); }, true); video.addeventlistener('timeupdate', function() { timeupdate = true; checkready(); }, true); video.src = url; video.play(); ...
... function checkready() { if (playing && timeupdate) { copyvideo = true; } } return video; } first we create a video element.
...we then set up two events to make sure the video is playing and the time has been updated.
...And 3 more matches
Using the Web Animations API - Web APIs
if your keyframe list has only one entry, element.animate() may throw a notsupportederror exception in some browsers until they are updated.
...terations (by default, animations iterate once), we could pass in the milliseconds alone: document.getelementbyid("alice").animate( [ { transform: 'rotate(0) translate3d(-50%, -50%, 0)', color: '#000' }, { color: '#431236', offset: 0.3}, { transform: 'rotate(360deg) translate3d(-50%, -50%, 0)', color: '#000' } ], 3000); controlling playback with play(), pause(), reverse(), and updateplaybackrate() while we can write css animations with the web animations api, where the api really comes in handy is manipulating the animation’s playback.
...we use updateplaybackrate() instead of setting the playbackrate directly since that produces a smooth update: setinterval( function() { // make sure the playback rate never falls below .4 if (redqueen_alice.playbackrate > .4) { redqueen_alice.updateplaybackrate(redqueen_alice.playbackrate * .9); } }, 3000); but urging them on by clicking or tapping causes them to speed up by multiplying their pla...
...And 3 more matches
Web audio spatialization basics - Web APIs
s transforms let transform = { xaxis: 0, yaxis: 0, zaxis: 0.8, rotatex: 0, rotatey: 0 } // set our bounds const topbound = -posy; const bottombound = posy; const rightbound = posx; const leftbound = -posx; const innerbound = 0.1; const outerbound = 1.5; let's create a function that takes the direction we want to move as a parameter, and both modifies the css transform and updates the position and orientation values of our panner node properties to change the sound as appropriate.
...we'll move the boombox along these axis and update the appropriate position.
...not only do we have to update two axis values (e.g.
...And 3 more matches
Creating a cross-browser video player - Developer guides
the span within the <progress> element is for browsers that do not support the progress element and will be updated at the same time as progress (this span element won't be visible on browsers that support progress).
... another event, timeupdate, is raised periodically as the video is being played through.
... video.addeventlistener('timeupdate', function() { progress.value = video.currenttime; progressbar.style.width = math.floor((video.currenttime / video.duration) * 100) + '%'; }); as the timeupdate event is raised, the progress element's value attribute is set to the video's currenttime.
...And 3 more matches
Mouse gesture events - Developer guides
mozmagnifygestureupdate the mozmagnifygestureupdate event is sent periodically while processing a magnify gesture, to provide updated status information.
... the event's delta value represents the amount by which the gesture has moved since the mozmagnifygesturestart or mozmagnifygestureupdate event.
...if you only care about the end results of the pinch gesture, you can simply watch for this event; however, if you want to provide feedback during the handling of the gesture, you should also watch the mozmagnifygesturestart and mozmagnifygestureupdate events.
...And 3 more matches
Making content editable - Developer guides
as of firefox 60, firefox will be updated to wrap the separate lines in <div> elements, matching the behavior of chrome, modern opera, edge, and safari.
...this is useful if your web application expects the older firefox behavior, and you don't want to or don't have the time to update it to use the new behavior.
...board.paste", "allaccess"); example: a simple but complete rich text editor <!doctype html> <html> <head> <title>rich text editor</title> <script type="text/javascript"> var odoc, sdeftxt; function initdoc() { odoc = document.getelementbyid("textbox"); sdeftxt = odoc.innerhtml; if (document.compform.switchmode.checked) { setdocmode(true); } } function formatdoc(scmd, svalue) { if (validatemode()) { document.execcommand(scmd, false, svalue); odoc.focus(); } } function validatemode() { if (!document.compform.switchmode.checked) { return true ; } alert("uncheck \"show html\"."); odoc.focus(); return false; } function setdocmode(btosource) { var ocontent; if (btosource) { ocontent = document.createtextnode(odoc.innerhtml); odoc.innerhtml = ""; var opre = docum...
...And 3 more matches
HTML attribute reference - HTML: Hypertext Markup Language
datetime <del>, <ins>, <time> indicates the date and time associated with the element.
... formnovalidate <button>, <input> if the button/input is a submit button (type="submit"), this boolean attribute specifies that the form is not to be validated when it is submitted.
... if this attribute is specified, it overrides the novalidate attribute of the button's form owner.
...And 3 more matches
<input type="email"> - HTML: Hypertext Markup Language
WebHTMLElementinputemail
the input value is automatically validated to ensure that it's either empty or a properly-formatted e-mail address (or list of addresses) before the form can be submitted.
...presenting an e-mail address, or empty events change and input supported common attributes autocomplete, list, maxlength, minlength, multiple, name,pattern, placeholder, readonly, required, size, and type idl attributes list and value methods select() value the <input> element's value attribute contains a domstring which is automatically validated as conforming to e-mail syntax.
... see validation for details on how e-mail addresses are validated to ensure that they're formatted properly.
...And 3 more matches
<input type="hidden"> - HTML: Hypertext Markup Language
WebHTMLElementinputhidden
tracking edited content one of the most common uses for hidden inputs is to keep track of what database record needs to be updated when an edit form is submitted.
... after editing, the user submits the form, and the updated data is sent back to the server to be updated in the database.
... the idea here is that during step 2, the id of the record being updated is kept in a hidden input.
...And 3 more matches
<input type="image"> - HTML: Hypertext Markup Language
WebHTMLElementinputimage
supported common attributes alt, src, width, height, formaction, formenctype, formmethod, formnovalidate, formtarget idl attributes none.
...s, image button inputs support the following attributes: attribute description alt alternate string to display when the image can't be shown formaction the url to which to submit the data formenctype the encoding method to use when submitting the form data formmethod the http method to use when submitting the form formnovalidate a boolean which, if present, indicates that the form shouldn't be validated before submission formtarget a string indicating a browsing context from where to load the results of submitting the form height the height, in css pixels, at which to draw the image src the url from which to load the image width the width, in css pixels, at which to draw...
... formnovalidate a boolean attribute which, if present, specifies that the form should not be validated before submission to the server.
...And 3 more matches
<input type="url"> - HTML: Hypertext Markup Language
WebHTMLElementinputurl
the input value is automatically validated to ensure that it's either empty or a properly-formatted url before the form can be submitted.
... value the <input> element's value attribute contains a domstring which is automatically validated as conforming to url syntax.
... see validation for details on how urls are validated to ensure that they're formatted properly.
...And 3 more matches
<input type="week"> - HTML: Hypertext Markup Language
WebHTMLElementinputweek
value a domstring representing a week and year, or empty events change and input supported common attributes autocomplete, list, readonly, and step idl attributes value, valueasdate, valueasnumber, and list.
...the format of the date and time value used by this input type is described in format of a valid week string in date and time formats used in html.
...this will be updated as soon as that information is determined.
...And 3 more matches
Warning - HTTP
WebHTTPHeadersWarning
note: the warning header is soon to be deprecated; see warning (https://github.com/httpwg/http-core/issues/139) and warning: header & stale-while-revalidate (https://github.com/whatwg/fetch/issues/913) for more details.
... header type general header forbidden header name no syntax warning: <warn-code> <warn-agent> <warn-text> [<warn-date>] directives <warn-code> a three-digit warning number.
... <warn-date> optional.
...And 3 more matches
Proxy Auto-Configuration (PAC) file - HTTP
ment these functions can be used in building the pac file: hostname based conditions isplainhostname() dnsdomainis() localhostordomainis() isresolvable() isinnet() related utility functions dnsresolve() convert_addr() myipaddress() dnsdomainlevels() url/hostname based conditions shexpmatch() time based conditions weekdayrange() daterange() timerange() logging utility alert() there was one associative array (object) already defined, because at the time javascript code was unable to define it by itself: proxyconfig.bindings note: pactester (part of the pacparser package) was used to test the following syntax examples.
... // returns true monday through friday (local timezone) weekdayrange("mon", "fri", "gmt"); // returns true monday through friday (gmt timezone) weekdayrange("sat"); // returns true on saturdays local time weekdayrange("sat", "gmt"); // returns true on saturdays gmt time weekdayrange("fri", "mon"); // returns true friday and monday only (note, order does matter!) daterange() syntax daterange(<day> | <month> | <year>, [gmt]) // ambiguity is resolved by assuming year is greater than 31 daterange(<day1>, <day2>, [gmt]) daterange(<month1>, <month2>, [gmt]) daterange(<year1>, <year2>, [gmt]) daterange(<day1>, <month1>, <day2>, <month2>, [gmt]) daterange(<month1>, <year1>, <month2>, <year2>, [gmt]) daterange(<day1>, <month1>, <year1>, <day2>, <month2>, <year2>, [...
... the order of the days, months, and years matter; before firefox 49, daterange("jan", "dec") will always evaluate to true.
...And 3 more matches
Codecs used by WebRTC - Web media technologies
which codecs can be within those tracks is not mandated by the webrtc specification.
... supported audio codecs the audio codecs which rfc 7874 mandates that all webrtc-compatible browsers must support are shown in the table below.
...neither g.711.0 (lossless compression), g.711.1 (wideband capability), nor any other extensions to the g.711 standard are mandated by webrtc.
...And 3 more matches
Communication between HTML and your extension - Archive of obsolete content
what i wanted to do was have an extension "look" for something on an html page and if it found that something perform some operation on the found thing and then update the status bar with the results of the operation.
...the onreadystatechange was set to another little javascript function that would update a specific element on the html page with the result.
...i wasn't sure about the difference between the capture or bubbling flag that you pass to addeventlistener but every time i would catch the event in the extension, the element from the ajax request wasn't fully updated into the html page.
...And 2 more matches
Chapter 6: Firefox extensions and XUL applications - Archive of obsolete content
watched variables appear under the watches tab, and are updated every time they are evaluated.
...update it with the contents of listing 3.
...open test_calc.js and update it with the method in listing 4.
...And 2 more matches
Creating a dynamic status bar extension - Archive of obsolete content
or, if you've already got the code from the creating a status bar extension sample, you can follow this tutorial to update that existing code with new features.
... download the sample update the install manifest replace all occurrences of the first sample's id, "status-bar-sample-1", with the new sample's id, "stockwatcher", and update the front end metadata to describe our new extension.
...update the chrome manifest the chrome manifest needs only a minor update from the previous sample; simply replace the id of the first sample, "status-bar-sample-1", with the name of the new sample, "stockwatcher".
...And 2 more matches
Enabling the behavior - retrieving tinderbox status - Archive of obsolete content
var gxmlhttprequest; function loadtinderboxstatus() { gxmlhttprequest = new xmlhttprequest(); gxmlhttprequest.onload = updatetinderboxstatus; gxmlhttprequest.open("get", "http://tinderbox.mozilla.org/seamonkey/panel.html"); gxmlhttprequest.send(null); } xmlhttprequest is an interface in mozilla for retrieving documents via http.
...that document gets updated by the tinderbox server every time a build finishes.
...we use new to create a new instance of it, set the instance's onload property to updatetinderboxstatus(), the function we want to execute when the document finishes loading, call its open method with the type of http request we want to make and the url of the document to retrieve, and then call its send method to send the request.
...And 2 more matches
Mozilla Crypto FAQ - Archive of obsolete content
i've updated this version of the mozilla crypto faq to discuss the situation now that the rsa public key algorithm is in the public domain and a full open source crypto implementation is being added to the mozilla code base.
...department of commerce press release announcing the new regulations as well as the updated regulations (pdf) themselves.
...for the statement by the bureau of export administration on notification requirements for mirror sites, see the section "notification requirements" in the bernstein advisory opinion contained in the letter dated february 17, 2000, from james lewis of bxa to cindy cohn, counsel for daniel bernstein.
...And 2 more matches
Standalone XPCOM - Archive of obsolete content
warning: the content of this article may be out of date.
... these instructions were last updated in 2000.
... get xpcom/tests directory upto date and documented.
...And 2 more matches
XUL Events - Archive of obsolete content
the event handler should be placed on an observer.checkboxstatechangethe checkboxstatechange event is executed when the state of a <checkbox> element has changed.closethe close event is executed when a request has been made to close the window when the user presses the close button.commandthe command event is executed when an element is activated.commandupdatethe commandupdate event is executed when a command update occurs on a <commandset>.
... this event would be used to update the disabled status of its commands.dommenuitemactivethe dommenuitemactive event is executed when a <menu> or a <menuitem> has been hovered or highlighted.dommenuiteminactivethe dommenuiteminactive event is executed when a <menu> or a <menuitem> in no longer hovered or highlighted.popuphiddenthe popuphidden event is executed when a <menupopup>, <panel> or <tooltip> has become hidden.popuphidingthe popuphiding event is executed when a <menupopup>, <panel> or <tooltip> is about to be hidden.popupshowingthe popupshowing event is executed when a <menupopup>, <panel> or <tooltip> is about to become visible.
... attribute: oncommand commandupdate this event occurs when a command update occurs on a <commandset> element.
...And 2 more matches
RDF Modifications - Archive of obsolete content
« previousnext » one of the most useful aspects of using templates with rdf datasources is that when the rdf datasource changes, for instance a new triple is added, or a triple is removed, the template updates accordingly, adding or removing result output as needed.
...the template builder uses these notifcations to update the template as necessary based on the new or removed information.
...the rdf observer also has two methods onbeginupdatebatch and onendupdatebatch.
...And 2 more matches
Tree Box Objects - Archive of obsolete content
the simplest is to call invalidaterow() which will redraw a specific row in the tree.
... the tree will call the view to get the updated data and update the contents of the tree on screen.
... other redrawing functions are invalidatecell() to redraw only a single cell invalidatecolumn() to redraw a column invalidaterange() to redraw a range of rows invalidate() to redraw the entire tree.
...And 2 more matches
textbox - Archive of obsolete content
visible controls have a disabled property which, except for menus and menuitems, is normally preferred to use of the attribute, as it may need to update additional state.
...the old name is retained for compatibility, but you should update your code.
...a listener for the command event should update search results.
...And 2 more matches
timepicker - Archive of obsolete content
the value may be retrieved and changed using the value property or the datevalue property.
... the former specifies the time as a string of the form hh:mm:ss whereas the latter specifies the time as a date object.
... attributes disabled, hideseconds, increment, readonly, tabindex, value properties amindicator, datevalue, disabled, hideseconds, hour, hourleadingzero, increment, is24hourclock, ispm, minute, minuteleadingzero, pmindicator, readonly, second, secondleadingzero, tabindex, value examples <timepicker value="12:05"/> attributes disabled type: boolean indicates whether the element is disabled or not.
...And 2 more matches
2006-10-06 - Archive of obsolete content
announcements firefox 2 release candidate 2 is now available for download beltzner announced ff2 rc2 is availabe for all 3 major platforms in some 40 langauges.
... rc2 testing update tim riley announced minimum tests for rc2 have been run and that rc2 is go for the final staging of the release.
... simon paquet asked for an update of the road map and either update or removal of the planning blog.
...And 2 more matches
-ms-ime-align - Archive of obsolete content
the -ms-ime-align css property is a microsoft extension aligning the input method editor (ime) candidate window box relative to the element on which the ime composition is active.
... ime candidate lists are positioned on the screen with sufficient size to allow basic text input.
... in the case of -ms-ime-align: after, an ime might adjust the candidate window and keyboard input behavior to provide a better user experience, such as using a horizontal candidate list and allowing some keys to be sent to the app for suggestion list navigation.
...And 2 more matches
Array.observe() - Archive of obsolete content
it's equivalent to object.observe() invoked with the accept type list ["add", "update", "delete", "splice"].
...one of "add", "update", "delete", or "splice".
... oldvalue: only for "update" and "delete" types.
...And 2 more matches
Object.observe() - Archive of obsolete content
one of "add", "update", or "delete".
... oldvalue: only for "update" and "delete" types.
...if omitted, the array ["add", "update", "delete", "reconfigure", "setprototype", "preventextensions"] will be used.
...And 2 more matches
Efficient animation for web games - Game development
requestanimationframe includes a domhighrestimestamp in its callback function prototype, which you definitely should use (as opposed to using the date object), as this will be the time the frame began rendering, and ought to make your animations look more fluid.
... if (progress < animationlength) { requestanimationframe(doanimation); } } // start animation requestanimationframe(doanimation); you will note that we set starttime to -1 at the beginning, when we could just as easily have set the time using the date() object and avoided the extra code in the animation callback.
...it is worth trying to batch similar operations, and to schedule them at a time when screen updates are unlikely to occur, or when such updates are of a more subtle nature.
...And 2 more matches
Assessment: Accessibility troubleshooting - Learn web development
can you update the article text to make it easier for screenreader users to navigate?
...which one should it be updated to?
... make the update.
...And 2 more matches
What is a Domain Name? - Learn web development
alternatively, if you use a system with a built-in shell, type a whois command into it, as shown here for mozilla.org: $ whois mozilla.org domain name:mozilla.org domain id: d1409563-lror creation date: 1998-01-24t05:00:00z updated date: 2013-12-08t01:16:57z registry expiry date: 2015-01-23t05:00:00z sponsoring registrar:markmonitor inc.
... (r37-lror) sponsoring registrar iana id: 292 whois server: referral url: domain status: clientdeleteprohibited domain status: clienttransferprohibited domain status: clientupdateprohibited registrant id:mmr-33684 registrant name:dns admin registrant organization:mozilla foundation registrant street: 650 castro st ste 300 registrant city:mountain view registrant state/province:ca registrant postal code:94041 registrant country:us registrant phone:+1.6509030800 as you can see, i can't register mozilla.org because the mozilla foundation has already registered it.
... whenever your registrar creates or updates any information for a given domain, the information must be refreshed in every dns database.
...And 2 more matches
Styling web forms - Learn web development
these include: <input type="color"> date-related controls such as <input type="datetime-local"> <input type="range"> <input type="file"> elements involved in creating dropdown widgets, including <select>, <option>, <optgroup> and <datalist>.
... the real problem with all these controls is that they have a very complex structure, and beyond some basic styling (such as changing the width or margin of the control) you generally don't have the ability to style the controls' internal components (such as the date picker calendar, or the button on the <select> that causes the options list to display) making up those widgets.
...on the left is the default rendering of an <input type="text">, <input type="date">, <select>, <textarea>, <input type="submit">, and a <button> in chrome on macos, with the platform's default font style in use.
...And 2 more matches
Marking up a letter - Learn web development
use an appropriate list type to mark up the semester start dates, study subjects, and exotic dances.
... the four dates in the document should be have appropriate elements containing machine-readable dates.
... the first address and first date in the letter should have a class attribute value of sender-column.
...And 2 more matches
From object to iframe — other embedding technologies - Learn web development
bel { margin: 0; text-align: right; font-size: 0.7rem; width: 98%; } body { margin: 10px; background: #f5f9fa; } const textarea = document.getelementbyid('code'); const reset = document.getelementbyid('reset'); const solution = document.getelementbyid('solution'); const output = document.queryselector('.output'); let code = textarea.value; let userentry = textarea.value; function updatecode() { output.innerhtml = textarea.value; } reset.addeventlistener('click', function() { textarea.value = code; userentry = textarea.value; solutionentry = htmlsolution; solution.value = 'show solution'; updatecode(); }); solution.addeventlistener('click', function() { if(solution.value === 'show solution') { textarea.value = solutionentry; solution.value = 'hide solution...
...'; } else { textarea.value = userentry; solution.value = 'show solution'; } updatecode(); }); const htmlsolution = '<iframe width="420" height="315" src="https://www.youtube.com/embed/qh2-tgulwu4" frameborder="0" allowfullscreen>\n</iframe>\n\n<iframe src="https://www.google.com/maps/embed?pb=!1m18!1m12!1m3!1d37995.65748333395!2d-2.273568166412784!3d53.473310471916975!2m3!1f0!2f0!3f0!3m2!1i1024!2i768!4f13.1!3m3!1m2!1s0x487bae6c05743d3d%3a0xf82fddd1e49fc0a1!2sthe+lowry!5e0!3m2!1sen!2suk!4v1518171785211" width="600" height="450" frameborder="0" style="border:0" allowfullscreen>\n</iframe>'; let solutionentry = htmlsolution; textarea.addeventlistener('input', updatecode); window.addeventlistener('load', updatecode); // stop tab key tabbing out of textarea and // make it write a t...
...nst caretpos = textarea.selectionstart; const front = (textarea.value).substring(0, caretpos); const back = (textarea.value).substring(textarea.selectionend, textarea.value.length); textarea.value = front + text + back; caretpos = caretpos + text.length; textarea.selectionstart = caretpos; textarea.selectionend = caretpos; textarea.focus(); textarea.scrolltop = scrollpos; } // update the saved usercode every time the user updates the text area code textarea.onkeyup = function(){ // we only want to save the state when the user code is being shown, // not the solution, so that solution is not saved over the user code if(solution.value === 'show solution') { userentry = textarea.value; } else { solutionentry = textarea.value; } updatecode(); }; iframes ...
...And 2 more matches
Index - Learn web development
every time a web page does more than just sit there and display static information for you to look at—displaying timely content updates, interactive maps, animated 2d/3d graphics, scrolling video jukeboxes, or more—you can bet that javascript is probably involved.
... 124 styling tables article, beginner, css, codingscripting, guide, needsupdate, styling, tables with styling tables now behind us, we need something else to occupy our time.
... 168 using css generated content basic, beginner, css, css:getting_started, graphics, guide, needsupdate, web this article describes some ways in which you can use css to add content when a document is displayed.
...And 2 more matches
Basic math in JavaScript — numbers and operators - Learn web development
for a start, note that you can't apply these directly to a number, which might seem strange, but we are assigning a variable a new updated value, not operating on the value itself.
... open in new window in the editable code box above, there are two lines marked with a comment that we'd like you to update to make the box grow/shrink to certain sizes, using certain operators and/or values in each case.
...for now, let's look at a quick example: <button>start machine</button> <p>the machine is stopped.</p> const btn = document.queryselector('button'); const txt = document.queryselector('p'); btn.addeventlistener('click', updatebtn); function updatebtn() { if (btn.textcontent === 'start machine') { btn.textcontent = 'stop machine'; txt.textcontent = 'the machine has started!'; } else { btn.textcontent = 'start machine'; txt.textcontent = 'the machine is stopped.'; } } open in new window you can see the equality operator being used just inside the updatebtn() function.
...And 2 more matches
Ember Interactivity: Footer functionality, conditional rendering - Learn web development
here we'll get the todo counter to update to show the correct number of todos still to complete, and correctly apply styling to completed todos (i.e.
...enter the following terminal command to do so: ember generate component-class footer next, go and find the newly-created todomvc/app/components/footer.js file and update it to the following: import component from '@glimmer/component'; import { inject as service } from '@ember/service'; export default class footercomponent extends component { @service('todo-data') todos; } now we need to go back to our todo-data.js file and add some functionality that will allow us to return the number of incomplete todos (useful for showing how many are left), and cle...
... to fix this, we need to update this part of the template to include some conditional rendering.
...And 2 more matches
Routing in Ember - Learn web development
to do this you’ll need to enter the following commands into your terminal, inside the root directory of your app: ember generate route index ember generate route completed ember generate route active the second and third commands should have not only generated new files, but also updated an existing file, app/router.js.
... the index route model first of all, update todomvc/app/routes/index.js so it looks as follows: import route from '@ember/routing/route'; import { inject as service } from '@ember/service'; export default class indexroute extends route { @service('todo-data') todos; model() { let todos = this.todos; return { get alltodos() { return todos.all; } } } } we can now update the todomvc/app/templates/ind...
... in this file, change <todolist /> to <todolist @todos={{ @model.alltodos }}/> the completed route model now update todomvc/app/routes/completed.js so it looks as follows: import route from '@ember/routing/route'; import { inject as service } from '@ember/service'; export default class completedroute extends route { @service('todo-data') todos; model() { let todos = this.todos; return { get completedtodos() { return todos.completed; } } } } we can now update the todomvc/app/templates/completed.hbs file so that when it includes the <todolist /> component, it does so ...
...And 2 more matches
Framework main features - Learn web development
this component should be responsible for tracking its own count state, and could be written like this: function counterbutton() { const [count] = usestate(0); return ( <button>clicked {count} times</button> ); } usestate() is a react hook which, given an initial data value, will keep track of that value as it is updated.
...let’s update our counterbutton code from above to allow it to count clicks: function counterbutton() { const [count, setcount] = usestate(0); return ( <button onclick={() => setcount(count + 1)}>clicked {count} times</button> ); } in this version we are using additional usestate() functionality to create a special setcount() function, which we can invoke to update the value of count.
...it's also excessive: home and article don’t actually make use of the author's portrait or byline, but if we want to get that information into the authorcredit, we will need to change home and author to accommodate it.
...And 2 more matches
Handling common JavaScript problems - Learn web development
to install it: install atom (if you haven't got an up-to-date version already installed) — download it from the atom page linked above.
...let's fix this problem by running the code once the load event has been fired — remove the console.log() line, and update this code block: let superheroes = request.response; populateheader(superheroes); showheroes(superheroes); to the following: request.onload = function() { let superheroes = request.response; populateheader(superheroes); showheroes(superheroes); } to summarize, anytime something is not working and a value does not appear to be what it is meant to be at some point in your code, you can us...
...at this point, the right-hand side will update to show some very useful information.
...And 2 more matches
Mozilla accessibility architecture
to see what parts of the accessibility cache need to be invalidated.
...we need to listen to some attribute changes because they might signal the need to invalidate parts of our cache; for example, if the name or href attribute on an anchor element changes, or the usemap attribute of an img changes.
...for example, this allows the msaa client to invalidate parts of its own cache or data model based on dom mutation events.
...And 2 more matches
Theme concepts
however, please feel free to update your themes to use any of the new features described here.
... updating static themes if your static theme is hosted on amo, you can upload a new version using the developer hub with the following steps: visit the product page for your theme through the developer hub select "upload new version" on the left upload your packaged file for validation or modify it using the theme generator for self-hosted static themes, a new version can be updated through amo by following the above steps or be handled by you through an updateurl or external application updates.
...next, you build a json object containing the same information you would use in a static theme’s manifest.json, finally, pass the json object in a theme.update() call.
...And 2 more matches
Embedding the editor
ensure that focus changes between editors update the window's notion of the "current" editor.
... if we continue to use window.editorshell, then this needs to be updated on focus changes.
...in composer, we'd have an implementation in js that talks to the existing commands, and updates the xul nodes.
...And 2 more matches
HTTP Cache
the consumer then indicates the cache entry needs to be revalidated by returning entry_needs_revalidation from oncacheentrycheck.
... the consumer is then responsible to validate the partial content cache entry with the network server and attempt to load the rest of the data.
... lifetime of an existing entry that doesn't pass server revalidation such a cache entry is first examined in the nsicacheentryopencallback.oncacheentrycheck callback, where the consumer finds out it must be revalidated with the server before use.
...And 2 more matches
DownloadTarget
this is a dynamic property, which is updated when the download is completed or when the download.refresh() method is called.
... this is a dynamic property, which is updated when the download finishes or whenever the download.refresh() method is called.
... methods refresh() updates the state of a finished, failed, or canceled download based on the current state as indicated by the file system.
...And 2 more matches
SVN for Localizers
when localizing websites, l10n-drivers will always add needed files to your repository or update your files with new strings in english.
... it's very important for you to update your working copy with the newest files from mozilla svn repository before you start making changes.
... enter the following command from the command-line: svn update your local svn repository (i.e., working directory) will be updated with the newest files from the url you initially cloned your repository from.
...And 2 more matches
NSS 3.15 release notes
certutil has been updated to support creating name constraints extensions.
...secitem_reallocitemv2 better matches caller expectations, in that it updates item->len on allocation.
... updated build instructions are available at migration to hg as part of this migration, the source code directory layout has been re-organized.
...And 2 more matches
NSS 3.24 release notes
nss 3.24 source distributions are available on ftp.mozilla.org for secure https download: source tarballs: https://ftp.mozilla.org/pub/mozilla.org/security/nss/releases/nss_3_24_rtm/src/ new in nss 3.24 nss 3.24 includes two nss softoken updates, a new function to configure ssl/tls server sockets, and two functions to improve the use of temporary arenas.
... new functionality nss softoken has been updated with the latest national institute of standards and technology (nist) guidance (as of 2015): software integrity checks and post functions are executed on shared library load.
... nss softoken has also been updated to allow nss to run in fips level 1 (no password).
...And 2 more matches
NSS 3.50 release notes
notable changes in nss 3.50 verified primitives from hacl* were updated, bringing performance improvements for several platforms.
... updated dtls 1.3 implementation to draft-30.
... bugs fixed in nss 3.50 bug 1599514 - update dtls 1.3 implementation to draft-30 bug 1603438 - fix native tools build failure due to lack of zlib include dir if external bug 1599603 - nist sp800-108 kbkdf - pkcs#11 implementation bug 1606992 - cache the most recent pbkdf1 password hash, to speed up repeated sdr operations, important with the increased kdf iteration counts.
...And 2 more matches
FIPS mode of operation
fc_encryptinit fc_encrypt fc_encryptupdate fc_encryptfinal decryption functions these functions support triple des and aes in ecb and cbc modes.
... fc_decryptinit fc_decrypt fc_decryptupdate fc_decryptfinal message digesting functions these functions support sha-1, sha-256, sha-384, and sha-512.
... fc_digestinit fc_digest fc_digestupdate fc_digestkey fc_digestfinal signature and mac generation functions these functions support dsa, rsa, ecdsa, and hmac.
...And 2 more matches
NSS_3.12.3_release_notes.html
backwards compatibility (wildcards) bug 334678: prng_fips1861.c redefines the macro bsize on hp-ux bug 335016: mpp_pprime (miller-rabin probabilistic primality test) may choose 0 or 1 as the random integer bug 347037: make shlibsign depend on the softoken only bug 371522: auto-update of crls stops after first update bug 380784: pk11mode in non fips mode failed.
... bug 472319: vfychain validates chain even if revoked certificate.
... bug 473357: ssltap incorrectly parses handshake messages that span record boundaries bug 473365: incompatible argument in pkix_validate.c.
...And 2 more matches
Necko Architecture
warning: the content of this article may be out of date.
... it was last updated in 1999.
...necko has been designed to accommodate pluggable protocols so developers can contribute their own protocol libraries that can be dynamically loaded and used by applications utilizing necko.
...And 2 more matches
How to embed the JavaScript engine
// time you're spinning the event loop js::rootedobject global(cx, js_newglobalobject(cx, &global_class, nullptr)); if (!global) return 1; js::rootedvalue rval(cx); { // scope for jsautocompartment jsautocompartment ac(cx, global); js_initstandardclasses(cx, global); const char *script = "'hello'+'world, it is '+new date()"; const char *filename = "noname"; int lineno = 1; bool ok = js_evaluatescript(cx, global, script, strlen(script), filename, lineno, rval.address()); if (!ok) return 1; } jsstring *str = rval.tostring(); printf("%s\n", js_encodestring(cx, str)); } js_destroycontext(cx); js_destroyruntime(rt); js_shutdown(); return...
...me you're spinning the event loop js::rootedobject global(cx, js_newglobalobject(cx, &global_class, nullptr, js::fireonnewglobalhook)); if (!global) return 1; js::rootedvalue rval(cx); { // scope for jsautocompartment jsautocompartment ac(cx, global); js_initstandardclasses(cx, global); const char *script = "'hello'+'world, it is '+new date()"; const char *filename = "noname"; int lineno = 1; bool ok = js_evaluatescript(cx, global, script, strlen(script), filename, lineno, &rval); if (!ok) return 1; } jsstring *str = rval.tostring(); printf("%s\n", js_encodestring(cx, str)); } js_destroycontext(cx); js_destroyruntime(rt); js_shutdown(); return 0; } s...
...me you're spinning the event loop js::rootedobject global(cx, js_newglobalobject(cx, &global_class, nullptr, js::fireonnewglobalhook)); if (!global) return 1; js::rootedvalue rval(cx); { // scope for jsautocompartment jsautocompartment ac(cx, global); js_initstandardclasses(cx, global); const char *script = "'hello'+'world, it is '+new date()"; const char *filename = "noname"; int lineno = 1; js::compileoptions opts(cx); opts.setfileandline(filename, lineno); bool ok = js::evaluate(cx, global, opts, script, strlen(script), &rval); if (!ok) return 1; } jsstring *str = rval.tostring(); printf("%s\n", js_encodestring(cx, str)); } js_destroycontext(cx)...
...And 2 more matches
JSAPI User Guide
a js::value can be a number, a string, a boolean value, a reference to an object (like an object, array, date, or function), or one of the special values null or undefined.
... deploy security updates - firefox automatically installs updates, so security fixes are deployed as soon as they are available.
... unless you also regularly deploy spidermonkey security updates, a determined hacker could use publicly known bugs in the engine to attack your application.
...And 2 more matches
Parser API
interface forstatement <: statement { type: "forstatement"; init: variabledeclaration | expression | null; test: expression | null; update: expression | null; body: statement; } a for statement.
... interface updateexpression <: expression { type: "updateexpression"; operator: updateoperator; argument: expression; prefix: boolean; } an update (increment or decrement) operator expression.
... enum updateoperator { "++" | "--" } an update (increment or decrement) operator token.
...And 2 more matches
Shell global objects
datenow() return the current time with sub-ms precision.
...the added functions and their behavior are experimental: don't depend upon them unless you're willing to update your code if these experimental apis change underneath you.
... isasmjsmodule(fn) returns whether the given value is a function containing "use asm" that has been validated according to the asm.js spec.
...And 2 more matches
WebReplayRoadmap
in a non-recording tab this will update the console whenever the log point's location executes in the future.
... in a recording tab, however, this will update the console with messages for every time the location has ever been hit.
... this requires scanning the recording and the console will not update immediately.
...And 2 more matches
amIInstallTrigger
ced gecko 2.0 inherits from: nsisupports last changed in gecko 2.0 (firefox 4 / thunderbird 3.3 / seamonkey 2.1) method overview boolean enabled(); boolean install(in nsivariant aargs, [optional] in amiinstallcallback acallback); boolean installchrome(in pruint32 atype, in astring aurl, in astring askin); deprecated since gecko 2.0 boolean startsoftwareupdate(in astring aurl, [optional] in print32 aflags); deprecated since gecko 2.0 boolean updateenabled(); deprecated since gecko 2.0 constants retained for backwards compatibility.
... startsoftwareupdate starts installing a new add-on.
... boolean startsoftwareupdate( in astring aurl, in print32 aflags optional ); parameters aurl the url of the add-on.
...And 2 more matches
nsICryptoHMAC
1.0 66 introduced gecko 1.9 inherits from: nsisupports last changed in gecko 1.9 (firefox 3) method overview acstring finish(in prbool aascii); void init(in unsigned long aalgorithm, in nsikeyobject akeyobject); void reset(); void update([const, array, size_is(alen)] in octet adata, in unsigned long alen); void updatefromstream(in nsiinputstream astream, in unsigned long alen); constants hashing algorithms.
...update() void update( [const, array, size_is(alen)] in octet adata, in unsigned long alen ); parameters adata a buffer to calculate the hash over.
... updatefromstream() calculates and updates a new hash based on a given data stream.
...And 2 more matches
nsIMicrosummaryGenerator
1.0 66 introduced gecko 1.8 obsolete gecko 6.0 inherits from: nsisupports last changed in gecko 1.9 (firefox 3) warning: microsummary support was removed in gecko 6.0 (firefox 6.0 / thunderbird 6.0 / seamonkey 2.3) method overview long calculateupdateinterval(in nsidomnode apagecontent); boolean equals(in nsimicrosummarygenerator aother); astring generatemicrosummary(in nsidomnode apagecontent); attributes attribute type description loaded boolean has the generator itself (which may be a remote resource) been loaded.
...it tells us where the generator comes from and where to go for updates.
... methods calculateupdateinterval() calculates the interval until the microsummary should be updated for the next time, depending on the page content.
...And 2 more matches
nsIMicrosummaryObserver
pports last changed in gecko 1.9 (firefox 3) warning: microsummary support was removed in gecko 6.0 (firefox 6.0 / thunderbird 6.0 / seamonkey 2.3) method overview void oncontentloaded(in nsimicrosummary microsummary); void onelementappended(in nsimicrosummary microsummary); void onerror(in nsimicrosummary microsummary); methods oncontentloaded() called when an observed microsummary updates its content.
... since an observer might watch multiple microsummaries at the same time, the microsummary whose content has been updated gets passed to this handler.
... void oncontentloaded( in nsimicrosummary microsummary ); parameters microsummary the microsummary whose content has just been updated.
...And 2 more matches
nsIMsgDatabase
void markreadbydate(in prtime startdate, in prtime enddate, in nsmsgkeyarrayptr markedids); native code only!
... void getnewlist(out unsigned long count, array, size_is(count) out nsmsgkey newkeys); nsisimpleenumerator getcachedhits(in string asearchfolderuri); void refreshcache(in string asearchfolderuri, in unsigned long anumkeys, array, size_is (anumkeys) in nsmsgkey anewhits, out unsigned long anumbadhits, array, size_is(anumbadhits) out nsmsgkey astalehits); void updatehdrincache(in string asearchfolderuri, in nsimsgdbhdr ahdr, in boolean aadd); boolean hdrisincache(in string asearchfolderuri, in nsimsgdbhdr ahdr); attributes attribute type description dbfolderinfo nsidbfolderinfo readonly: firstnew nsmsgkey readonly: msgretentionsettings nsimsgretentionsettings msgdownloadsettings nsimsgdownloadsettings lowwaterarticlenum nsmsgkey readonly...
...ns_msg_error_folder_summary_out_of_date the database is present (and was opened), but the summary file is out of date.
...And 2 more matches
nsISmsDatabaseService
to create an instance, use: var smsservice = components.classes["@mozilla.org/sms/smsdatabaseservice;1"] .createinstance(components.interfaces.nsismsdatabaseservice); method overview long savereceivedmessage(in domstring asender, in domstring abody, in unsigned long long adate); long savesentmessage(in domstring areceiver, in domstring abody, in unsigned long long adate); void getmessage(in long messageid, in long requestid, [optional] in unsigned long long processid); void deletemessage(in long messageid, in long requestid, [optional] in unsigned long long processid); void createmessagelist(in nsidommozsmsfilter filter, in boolean reverse, in long requestid, [...
...oid getnextmessageinlist(in long listid, in long requestid, [optional] in unsigned long long processid); void clearmessagelist(in long listid); void markmessageread(in long messageid, in boolean value, in long requestid, [optional] in unsigned long long processid) methods savereceivedmessage() void savereceivedmessage( in domstring asender, in domstring abody, in unsigned long long adate ); parameters asender a domstring with the sender of the text message.
...adate the timestamp of the message.
...And 2 more matches
nsIXPConnect
onthistranslator(in nsiidref aiid, in nsixpcfunctionthistranslator atranslator); void setreportalljsexceptions(in boolean reportalljsexceptions); void setsafejscontextforcurrentthread(in jscontextptr cx); void setsecuritymanagerforjscontext(in jscontextptr ajscontext, in nsixpcsecuritymanager amanager, in pruint16 flags); void syncjscontexts(); void updatexows(in jscontextptr ajscontext, in nsixpconnectwrappednative aobject, in pruint32 away); native code only!
... deferreleasesuntilaftergarbagecollection prbool obsolete since gecko 1.9 pendingexception nsiexception constants constant value description init_js_standard_classes 1 << 0 flag_system_global_object 1 << 1 omit_components_object 1 << 2 xpc_xow_clearscope 1 tells updatexows() to clear the scope of all of the xows it finds.
... return value missing description exceptions thrown missing exception missing description getxpcwrappednativejsclassinfo() get the jsequalityop pointer to use for identifying jsobjects that hold a pointer to an nsixpconnectwrappednative or to the native in their private date.
...And 2 more matches
XPCOM Interface Reference
ozistorageprogresshandlermozistorageresultsetmozistoragerowmozistorageservicemozistoragestatementmozistoragestatementcallbackmozistoragestatementparamsmozistoragestatementrowmozistoragestatementwrappermozistoragevacuumparticipantmozistoragevaluearraymozitxttohtmlconvmozithirdpartyutilmozivisitinfomozivisitinfocallbackmozivisitstatuscallbacknsiabcardnsiaboutmodulensiabstractworkernsiaccelerometerupdatensiaccessnodensiaccessibilityservicensiaccessiblensiaccessiblecaretmoveeventnsiaccessiblecoordinatetypensiaccessibledocumentnsiaccessibleeditabletextnsiaccessibleeventnsiaccessiblehyperlinknsiaccessiblehypertextnsiaccessibleimagensiaccessibleprovidernsiaccessiblerelationnsiaccessibleretrievalnsiaccessiblerolensiaccessiblescrolltypensiaccessibleselectablensiaccessiblestatechangeeventnsiaccessiblest...
...cessibletablechangeeventnsiaccessibletextnsiaccessibletextchangeeventnsiaccessibletreecachensiaccessiblevaluensiaccessiblewin32objectnsialertsservicensiannotationobservernsiannotationservicensiappshellnsiappshellservicensiappstartupnsiappstartup_mozilla_2_0nsiapplicationcachensiapplicationcachechannelnsiapplicationcachecontainernsiapplicationcachenamespacensiapplicationcacheservicensiapplicationupdateservicensiarraynsiasyncinputstreamnsiasyncoutputstreamnsiasyncstreamcopiernsiasyncverifyredirectcallbacknsiauthinformationnsiauthmodulensiauthpromptnsiauthprompt2nsiauthpromptadapterfactorynsiauthpromptcallbacknsiauthpromptprovidernsiauthpromptwrappernsiautocompletecontrollernsiautocompleteinputnsiautocompleteitemnsiautocompletelistenernsiautocompleteobservernsiautocompleteresultnsiautocompletesea...
...ifeedresultnsifeedresultlistenernsifeedtextconstructnsifilensifileinputstreamnsifileoutputstreamnsifilepickernsifileprotocolhandlernsifilespecnsifilestreamsnsifileurlnsifileutilitiesnsifileviewnsifocusmanagernsiformhistory2nsiframeloadernsiframeloaderownernsiframemessagelistenernsiframemessagemanagernsiframescriptloadernsigsettingscollectionnsigsettingsservicensigeolocationprovidernsigeolocationupdatensiglobalhistorynsiglobalhistory2nsiglobalhistory3nsihtmleditornsihttpheaderlistenernsihapticfeedbacknsihttpactivitydistributornsihttpactivityobservernsihttpchannelnsihttpchannelinternalnsihttpheadervisitornsihttpservernsihttpupgradelistenernsiidnservicensiiframeboxobjectnsiiniparsernsiiniparserfactorynsiiniparserwriternsiioservicensiidleservicensiinprocesscontentframemessagemanagernsiinputstreamn...
...And 2 more matches
Xray vision
xrays for javascript objects until recently, built-in javascript objects that are not part of the dom, such as date, error, and object, did not get xray vision when accessed by more-privileged code.
...for example, if content code creates a new date object, it will usually be created as a property of a dom object, and then it will be filtered out by the dom xray: // content code // redefine date.getfullyear() date.prototype.getfullyear = function() {return 1000}; var date = new date(); // chrome code // contentwindow is an xray, and date is an expando on contentwindow // so date is filtered out gbrowser.contentwindow.date.getfullyear() // -> typeerror: gbrowser.contentwindow.date is undefined the chrome code will only even see date if it waives xrays, and then, because waiving is transitive, it should expect to be...
... vulnerable to redefinition: // chrome code components.utils.waivexrays(gbrowser.contentwindow).date.getfullyear(); // -> 1000 however, there are some situations in which privileged code will access javascript objects that are not themselves dom objects and are not properties of dom objects.
...And 2 more matches
Building a Thunderbird extension 6: Adding JavaScript
in this step we will create a small piece of javascript code that inserts the current date into our statusbar widget.
... window.addeventlistener("load", function(e) { startup(); }, false); window.setinterval( function() { startup(); }, 60000); //update date every minute function startup() { var mypanel = document.getelementbyid("my-panel"); var date = new date(); var day = date.getday(); var datestring = date.getfullyear() + "." + (date.getmonth()+1) + "." + date.getdate(); mypanel.label = "date: " + datestring; } the first part registers a new event listener that will be executed automatically when thunderbird loads.
...it then uses javascript's date class to get the current date, which it converts into a string that has the format of yyyy.mm.dd.
...And 2 more matches
Mozilla
creating a spell check dictionary add-on this page describes how to package a hunspell spell check dictionary as a firefox add-on, or how to update your existing add-on, so that it can be installed, uninstalled and updated without a restart.
... setting up an update server the goal of this document is to provide instructions for installing a locally-served firefox update.
...this format is used by the extension manager, software update, and other parts of the platform.
...And 2 more matches
Introduction to DOM Inspector - Firefox Developer Tools
the dom inspector keeps track of all the windows that are open, so to inspect the dom of a particular window in the dom inspector, simply access that window as you would normally and then choose its title from this dynamically updated menulist.
...by clicking around in the document pane, you'll see that the viewers are linked; whenever you select a new node from the dom nodes viewer, the dom node viewer is automatically updated to reflect the information for that node.
... updating the dom dynamically another feature to mention in this introduction is the ability is the ability the dom inspector gives you to dynamically update information reflected in the dom about web pages, user interface, and other elements.
...And 2 more matches
Network request details - Firefox Developer Tools
sults through a json validator): { "response headers (1.113 kb)": { "headers": [ { "name": "accept-ranges", "value": "bytes" }, { "name": "age", "value": "0" }, { "name": "backend-timing", "value": "d=74716 t=1560258099074460" }, { "name": "cache-control", "value": "private, must-revalidate, max-age=0" }, { "name": "content-disposition", "value": "inline; filename=api-result.js" }, { "name": "content-encoding", "value": "gzip" }, { "name": "content-length", "value": "673" }, { "name": "content-type", "value": "text/javascript; charset=utf-8" }, { "name"...
...: "date", "value": "tue, 11 jun 2019 13:01:39 gmt" }, { "name": "mediawiki-login-suppressed", "value": "true" }, { "name": "p3p", "value": "cp=\"this is not a p3p policy!
... these details include: last fetched: the date the resource was last fetched fetched count: the number of times in the current session that the resource has been fetched data size: the size of the resource.
...And 2 more matches
Constraint validation API - Web APIs
therefore, you need to also validate input values on the server side, in a way that is consistent with what is done on the client side.
...together, they help explain whether and why an element's value fails to validate.
... validationmessage a read-only property that returns an empty string if the element is not a candidate for constraint validation, or if the element's value is valid.
...And 2 more matches
Using files from web applications - Web APIs
ctype html> <html> <head> <meta charset="utf-8"> <title>file(s) size</title> </head> <body> <form name="uploadform"> <div> <input id="uploadinput" type="file" name="myfiles" multiple> selected files: <span id="filenum">0</span>; total size: <span id="filesize">0</span> </div> <div><input type="submit" value="send file"></div> </form> <script> function updatesize() { let nbytes = 0, ofiles = this.files, nfiles = ofiles.length; for (let nfileid = 0; nfileid < nfiles; nfileid++) { nbytes += ofiles[nfileid].size; } let soutput = nbytes + " bytes"; // optional code for multiples approximation const amultiples = ["kib", "mib", "gib", "tib", "pib", "eib", "zib", "yib"]; for (nmultiple = 0, napprox = nbytes /...
... 1024; napprox > 1; napprox /= 1024, nmultiple++) { soutput = napprox.tofixed(3) + " " + amultiples[nmultiple] + " (" + nbytes + " bytes)"; } // end of optional code document.getelementbyid("filenum").innerhtml = nfiles; document.getelementbyid("filesize").innerhtml = soutput; } document.getelementbyid("uploadinput").addeventlistener("change", updatesize, false); </script> </body> </html> using hidden file input elements using the click() method you can hide the admittedly ugly file <input> element and present your own interface for opening the file picker and displaying which file or files the user has selected.
... function fileupload(img, file) { const reader = new filereader(); this.ctrl = createthrobber(img); const xhr = new xmlhttprequest(); this.xhr = xhr; const self = this; this.xhr.upload.addeventlistener("progress", function(e) { if (e.lengthcomputable) { const percentage = math.round((e.loaded * 100) / e.total); self.ctrl.update(percentage); } }, false); xhr.upload.addeventlistener("load", function(e){ self.ctrl.update(100); const canvas = self.ctrl.ctx.canvas; canvas.parentnode.removechild(canvas); }, false); xhr.open("post", "http://demos.hacks.mozilla.org/paul/demos/resources/webservices/devnull.php"); xhr.overridemimetype('text/plain; charset=x-user-defined-bin...
...And 2 more matches
File.lastModified - Web APIs
WebAPIFilelastModified
the file.lastmodified read-only property provides the last modified date of the file as the number of milliseconds since the unix epoch (january 1, 1970 at midnight).
... files without a known last modified date return the current date.
... example reading from file input <input type="file" multiple id="fileinput"> const fileinput = document.queryselector('#fileinput'); fileinput.addeventlistener('change', (event) => { // files is a filelist object (similar to nodelist) const files = event.target.files; for (let file of files) { const date = new date(file.lastmodified); console.log(`${file.name} has a last modified date of ${date}`); } }); try the results out below: dynamically created files if a file is created dynamically, the last modified time can be supplied in the new file() constructor function.
...And 2 more matches
HTMLButtonElement - Web APIs
htmlbuttonelement.formnovalidate is a boolean indicating that the form is not to be validated when it is submitted.
... if specified, this attribute overrides the novalidate attribute of the <form> element that owns this element.
... htmlbuttonelement.willvalidate read only is a boolean indicating whether the button is a candidate for constraint validation.
...And 2 more matches
HTMLObjectElement - Web APIs
this is the empty string if the control is not a candidate for constraint validation (willvalidate is false), or it satisfies its constraints.
... htmlobjectelement.willvalidate read only returns a boolean that indicates whether the element is a candidate for constraint validation.
... htmlobjectelement.checkvalidity() retuns a boolean that always is true, because object objects are never candidates for constraint validation.
...And 2 more matches
PayerErrors.name - Web APIs
WebAPIPayerErrorsname
the name property is included in a payererrors object if the payername returned in the response couldn't be validated.
...if the payer's name validated successfully, the name property is omitted from the payererrors object.
... syntax payername = payererrors.name; value if this property is present in the payererrors object, the payer's name couldn't be successfully validated, and the name property's value is a domstring explaining the error.
...And 2 more matches
PayerErrors.phone - Web APIs
WebAPIPayerErrorsphone
the phone property is found in a payererrors object if the payername returned in the response couldn't be validated as a valid phone number.
...if the payer's phone number validated successfully, the phone property is omitted from the payererrors object.
... syntax payerphone = payererrors.phone; value if this property is present in the payererrors object, the payer's phone number couldn't be successfully validated, and the phone property's value is a domstring explaining the error.
...And 2 more matches
PaymentRequest: merchantvalidation event - Web APIs
merchantvalidation events are delivered by the payment request api to a paymentrequest object when a payment handler requires that the merchant requesting the purchase validate itself as permitted to use the payment handler.
... request.addeventlistener("merchantvalidation", event => { event.complete(async () => { const merchantserverurl = window.location.origin + '/validate?url=' + encodeuricomponent(event.validationurl); // get validation data, and complete validation; return await fetch(merchantserverurl).then(response => response.text()); }, false); }; const response = await request.show(); how merchant server handles the validation depends on the server implementation and payment method documentation.
...this response lets the payment handler know if the merchant is validated.
...And 2 more matches
PaymentRequest: paymentmethodchange event - Web APIs
the code assumes the existence of a method detailsforshipping(), which returns a paymentdetailsupdate object containing the shipping options for the ground shipping method, in the form found in the paymentshippingoption dictionary.
... detailsforshipping("ground"), options); paymentrequest.addeventlistener("paymentmethodchange", handlepaymentchange, false); paymentrequest.show() .then(response => response.complete("success")) .catch(err => console.log("error handling payment request: " + err)); the event handler function itself, handlepaymentchange(), looks like this: handlepaymentchange = event => { const detailsupdate = {}; if (event.methodname === "https://apple.com/apple-pay") { const servicefeeinfo = calculateservicefee(event.methoddetails); object.assign(detailsupdate, servicefeeinfo); } event.updatewith(detailsupdate); }, false); this begins by looking at the event's methodname property; if that indicates that the user is trying to use apple pay, we pass the methoddetails into a function...
... called calculateservicefee(), which we might create to take the information about the transaction, such as the underlying credit card being used to service the apple pay request, and compute and return an paymentdetailsupdate object that specifies changes to be applied to the paymentrequest in order to add any service fees that the payment method might require.
...And 2 more matches
PaymentRequest: shippingaddresschange event - Web APIs
bubbles no cancelable no interface paymentrequestupdateevent event handler property onshippingaddresschange usage notes depending on the browser, the shipping address information may be redacted for privacy reasons.
... example in this example, a handler for the shippingaddresschange event is set up to validate that the address meets requirements set by the web application.
... const paymentrequest = new paymentrequest(methoddata, details, options); paymentrequest.addeventlistener("shippingaddresschange", event => { let detailsupdate = checkaddress(paymentrequest.shippingaddress); event.updatewith(detailsupate); }, false); const checkaddress = theaddress => { let detailsupdate = {}; // check the address, return a paymentdetailsupdate object // with any changes or errors.
...And 2 more matches
PaymentRequest: shippingoptionchange event - Web APIs
bubbles no cancelable no interface paymentrequestupdateevent event handler property onshippingoptionchange examples this code snippet sets up a handler for the shippingoptionchange event.
... paymentrequest.addeventlistener("shippingoptionchange", event => { const value = calculatenewtotal(paymentrequest.shippingoption); const total = { currency: "eur", label: "total due", value, }; event.updatewith({ total }); }, false); after caling a custom function, calculatenewtotal(), to compute the updated total based on the newly-selected shipping option as specified by the shippingoption.
... the revised total is submitted back to the payment request by calling the event's updatewith() method.
...And 2 more matches
PaymentResponse: payerdetailchange event - Web APIs
if any are invalid, appropriate error messages should be configured and the retry() method should be called on the paymentresponse to ask the user to update the invalid entries.
... bubbles no cancelable no interface paymentrequestupdateevent event handler property onpayerdetailchange examples in the example below, onpayerdetailchange is used to set up a listener for the payerdetailchange event in order to validate the information entered by the user, requesting that any mistakes be corrected // options for paymentrequest(), indicating that shipping address, // payer email address, name, and phone number all be collected.
... response.onpayerdetailchange = async ev => { const promisestovalidate = []; const { payername, payeremail, payerphone } = response; // validate each value which changed by calling a function // that validates each type of data, returning a promise which // resolves if the data is valid.
...And 2 more matches
PaymentResponse.retry() - Web APIs
validate the returned reponse; if there are any fields whose values are not acceptable, call the response's complete() method with a value of "fail" to indicate failure.
...} async function dopaymentrequest() { const request = new paymentrequest(methoddata, details, options); const response = await request.show(); await recursivevalidate(request, response); await response.complete("success"); } // keep validating until the data looks good!
... async function recursivevalidate(request, response) { const promisestofixthings = []; const errors = await validate(request, response); if (!errors) { return; } if (errors.shippingaddress) { // "shippingaddresschange" fired at request object const promise = fixfield(request, "shippingaddresschange", shippingvalidator); promisestofixthings.push(promise); } if (errors.payer) { // "payerdetailchange" fired at response object const promise = fixfield(response, "payerdetailchange", payervalidator); promisestofixthings.push(promise); } await promise.all([response.retry(errors), ...promisestofixthings]); await recursivevalidate(request, response); } function fixfield(requestorresponse, event, validator) { return new promise(resolve => { // brows...
...And 2 more matches
Pointer Lock API - Web APIs
if so, it attached an event listener to handle the mouse movements with the updateposition() function.
... function lockchangealert() { if (document.pointerlockelement === canvas || document.mozpointerlockelement === canvas) { console.log('the pointer lock status is now locked'); document.addeventlistener("mousemove", updateposition, false); } else { console.log('the pointer lock status is now unlocked'); document.removeeventlistener("mousemove", updateposition, false); } } the updateposition() function updates the position of the ball on the canvas (x and y), and also includes if() statements to check whether the ball has gone off the edges of the canvas.
...it also includes a check whether a requestanimationframe() call has previously been made, and if so, calls it again as required, and calls the canvasdraw() function that updates the canvas scene.
...And 2 more matches
RTCIceGathererState - Web APIs
values "new" the rtcicetransport is newly created and has not yet started to gather ice candidates.
... "gathering" the transport is in the process of gathering candidates.
... "complete" the transport has finished gathering ice candidates and has sent the end-of-candidates indicator to the remote device.
...And 2 more matches
RTCIceTransport.gatheringState - Web APIs
syntax gatherstate = rtcicetransport.gatheringstate; value a string from the rtcicegathererstate enumerated type whose value indicates the current state of the ice agent's candidate gathering process: "new" the rtcicetransport is newly created and has not yet started to gather ice candidates.
... "gathering" the transport is in the process of gathering candidates.
... "complete" the transport has finished gathering ice candidates and has sent the end-of-candidates indicator to the remote device.
...And 2 more matches
RTCIceTransport: gatheringstatechange event - Web APIs
a gatheringstatechange event is sent to an rtcicetransport when its ice candidate gathering state changes.
... the gathering state, whose actual status can be found in the transport object's gatheringstate property, indicates whether or not the ice agent has begun gathering candidates, and if so, if it has finished doing so.
...in contrast, gatheringstatechange represents changes to the candidate gathering state for a single transport.
...And 2 more matches
RTCPeerConnection.iceGatheringState - Web APIs
this lets you detect, for example, when collection of ice candidates has finished.
... "gathering" the ice agent is in the process of gathering candidates for the connection.
... "complete" the ice agent has finished gathering candidates.
...And 2 more matches
SVGAngle - Web APIs
WebAPISVGAngle
the associated element is used to determine which element's content attribute to update if the object reflects an attribute.
...setting this attribute will cause valueinspecifiedunits and valueasstring to be updated automatically to reflect this setting.
...setting this attribute will cause value and valueasstring to be updated automatically to reflect this setting.
...And 2 more matches
SVGSVGElement - Web APIs
each candidate graphics element is to be considered a match only if the same graphics element can be a target of pointer events as defined in pointer-events processing.
...each candidate graphics element is to be considered a match only if the same graphics element can be a target of pointer events as defined in pointer-events processing.
...each candidate graphics element is to be considered a match only if the same graphics element can be a target of pointer events as defined in pointer-events processing.
...And 2 more matches
Screen Wake Lock API - Web APIs
examples feature detection this code checks for wake lock support and updates the ui accordingly.
...the wakelock.request method is promise based and so we can create an asynchronous function, which in turn updates the ui to reflect the wake lock is active.
... wakelock.release() .then(() => { wakelock = null; }); listening for wake lock release this example updates the ui if the wake lock has been released for any reason (such as navigating away from the active window/tab).
...And 2 more matches
ServiceWorkerRegistration - Web APIs
event handlers serviceworkerregistration.onupdatefound read only an eventlistener property called whenever an event of type updatefound is fired; it is fired any time the serviceworkerregistration.installing property acquires a new service worker.
... serviceworkerregistration.update() checks the server for an updated version of the service worker without consulting caches.
...next, it adds an updatefound listener in which it uses the service worker registration to listen for further changes to the service worker's state.
...And 2 more matches
Using Service Workers - Web APIs
this doesn’t have much of a distinct use the first time your service worker is installed/activated, but it means more when the service worker is updated (see the updating your service worker section later on.) note: localstorage works in a similar way to service worker cache, but it is synchronous, so not allowed in service workers.
... a service worker is fetched, which includes the documents inside the specified scope, and any resources referenced in those documents (for example if index.html makes a cross origin request to embed an image, that still goes through its service worker.) you can attach a fetch event listener to the service worker, then call the respondwith() method on the event to hijack our http responses and update them with your own magic.
...resp || fetch(event.request).then((response) => { let responseclone = response.clone(); caches.open('v1').then((cache) => { cache.put(event.request, responseclone); }); return response; }); }).catch(() => { return caches.match('./sw-test/gallery/mylittlevader.jpg'); }) ); }); we have opted for this fallback image because the only updates that are likely to fail are new images, as everything else is depended on for installation in the install event listener we saw earlier.
...And 2 more matches
Lighting in WebGL - Web APIs
then we update the vertex shader to adjust the color of each vertex, taking into account the ambient lighting as well as the effect of the directional lighting given the angle at which it's striking the face.
... const normalize = false; const stride = 0; const offset = 0; gl.bindbuffer(gl.array_buffer, buffers.normal); gl.vertexattribpointer( programinfo.attriblocations.vertexnormal, numcomponents, type, normalize, stride, offset); gl.enablevertexattribarray( programinfo.attriblocations.vertexnormal); } finally, we need to update the code that builds the uniform matrices to generate and deliver to the shader a normal matrix, which is used to transform the normals when dealing with the current orientation of the cube in relation to the light source: const normalmatrix = mat4.create(); mat4.invert(normalmatrix, modelviewmatrix); mat4.transpose(normalmatrix, normalmatrix); ...
... gl.uniformmatrix4fv( programinfo.uniformlocations.normalmatrix, false, normalmatrix); update the shaders now that all the data the shaders need is available to them, we need to update the code in the shaders themselves.
...And 2 more matches
Web Authentication API - Web APIs
browser calls authenticatormakecredential() on authenticator - internally, the browser will validate the parameters and fill in any defaults, which become the authenticatorresponse.clientdatajson.
...the public key will become part of the attestation, which the authenticator will sign over with a private key that was burned into the authenticator during its manufacturing process and that has a certificate chain that can be validated back to a root of trust.
... server validates and finalizes registration - finally, the server is required to perform a series of checks to ensure that the registration was complete and not tampered with.
...And 2 more matches
ARIA: timer role - Accessibility
while the value does not necessarily need to be machine parsable, it should continuously update at regular intervals unless the timer is paused or reaches its end-point.
...the clock is updated each minute, with the new remaining time simply overwriting the current content.
... <div id="clock" role="timer" aria-live="off">20</div> <button onclick="starttimer('clock')">start</button> /* basic javascript to update a timer */ function starttimer(timername) { // get the number of seconds let timer = document.getelementbyid(timername), seconds = parseint(timer.innertext); // remove a second // updated the content of timer timer.innertext = --seconds // if timer != 0, settimeout if (seconds) { settimeout( function() { starttimer(timername); }, 1000); } } the first time the function executes, the entirety of the string that is added will be announced.
...And 2 more matches
Accessibility documentation index - Accessibility
7 aria live regions aria, accessibility, arialive using javascript, it is possible to dynamically change parts of a page without requiring the entire page to reload — for instance, to update a list of search results on the fly, or to display a discreet alert or notification which does not require user interaction.
... 51 aria: alert role aria, aria role, aria alert, aria widget, reference the alert role can be used to tell the user an element has been dynamically updated.
... screen readers will instantly start reading out the updated content when the role is added.
...And 2 more matches
Ordering Flex Items - CSS: Cascading Style Sheets
you should always take the source order as the logical order of the document as all up-to-date user agents will be following the specification and doing so.
...the card also has a date; the finished design we want to create is something like this.
... visually the date appears above the heading, in the source.
...And 2 more matches
CSS Grid Layout and Progressive Enhancement - CSS: Cascading Style Sheets
this early specification did not contain all of the properties and values that the up-to-date specification has.
...as these properties are vendor prefixed, they will not effect any browser supporting the up to date and unprefixed specification.
... autoprefixer grid layout support the popular tool autoprefixer has been updated to support the -ms- grid version.
...And 2 more matches
Rich-Text Editing in Mozilla - Developer guides
note: this document is out-of-date; you are advised to consult the more up-to-date document available at making content editable.
...).contentwindow.focus() } example: a simple but complete rich text editor <!doctype html> <html> <head> <title>rich text editor</title> <script type="text/javascript"> var odoc, sdeftxt; function initdoc() { odoc = document.getelementbyid("textbox"); sdeftxt = odoc.innerhtml; if (document.compform.switchmode.checked) { setdocmode(true); } } function formatdoc(scmd, svalue) { if (validatemode()) { document.execcommand(scmd, false, svalue); odoc.focus(); } } function validatemode() { if (!document.compform.switchmode.checked) { return true ; } alert("uncheck \"show html\"."); odoc.focus(); return false; } function setdocmode(btosource) { var ocontent; if (btosource) { ocontent = document.createtextnode(odoc.innerhtml); odoc.innerhtml = ""; var opre = docum...
...tenteditable = true; opre.appendchild(ocontent); odoc.appendchild(opre); } else { if (document.all) { odoc.innerhtml = odoc.innertext; } else { ocontent = document.createrange(); ocontent.selectnodecontents(odoc.firstchild); odoc.innerhtml = ocontent.tostring(); } odoc.contenteditable = true; } odoc.focus(); } function printdoc() { if (!validatemode()) { return; } var oprntwin = window.open("","_blank","width=450,height=470,left=400,top=100,menubar=yes,toolbar=no,location=no,scrollbars=yes"); oprntwin.document.open(); oprntwin.document.write("<!doctype html><html><head><title>print<\/title><\/head><body onload=\"print();\">" + odoc.innerhtml + "<\/body><\/html>"); oprntwin.document.close(); } </script> <style type="text/css"> .in...
...And 2 more matches
Index - Developer guides
WebGuideIndex
17 event developer guide dom, event, guide, needsupdate, events events refers both to a design pattern used for the asynchronous handling of various incidents which occur in the lifetime of a web page and to the naming, characterization, and use of a large number of incidents of different types.
... 19 dom onevent handlers beginner, dom, dom beginner, needsbeginnerupdate, needsupdate the web platform provides several ways to be notified of dom events.
... 24 overview of events and handlers beginner, dom, example, javascript, needsbeginnerupdate, needsupdate, events this overview of events and event handling explains the code design pattern used to react to incidents occurring when a browser accesses a web page, and it summarizes the types of such incidents modern web browsers can handle.
...And 2 more matches
The HTML autocomplete attribute - HTML: Hypertext Markup Language
"cc-exp" a payment method expiration date, typically in the form "mm/yy" or "mm/yyyy".
... "bday" a birth date, as a full date.
... "bday-day" the day of the month of a birth date.
...And 2 more matches
HTML attribute: step - HTML: Hypertext Markup Language
WebHTMLAttributesstep
valid for the numeric input types, including the date, month, week, time, datetime-local, number and range types, the step attribute is a number that specifies the granularity that the value must adhere to or the keyword any.
... the step sets the stepping interval when clicking up and down spinner buttons, moving a slider left and right on a range, and validating the different date types.
... if not explicitly included, step defaults to 1 for number and range, and 1 unit type (minute, week, month, day) for the date/time input types.
...And 2 more matches
<article>: The Article Contents element - HTML: Hypertext Markup Language
WebHTMLElementarticle
the publication date and time of an <article> element can be described using the datetime attribute of a <time> element.
... note that the pubdate attribute of <time> is no longer a part of the w3c html5 standard.
... examples <article class="film_review"> <header> <h2>jurassic park</h2> </header> <section class="main_review"> <p>dinos were great!</p> </section> <section class="user_reviews"> <article class="user_review"> <p>way too scary for me.</p> <footer> <p> posted on <time datetime="2015-05-16 19:00">may 16</time> by lisa.
...And 2 more matches
itemprop - HTML: Hypertext Markup Language
op="name">panasonic white 60l refrigerator</span> <img src="panasonic-fridge-60l-white.jpg" alt=""> <div itemprop="aggregaterating" itemscope itemtype="http://schema.org/aggregaterating"> <meter itemprop="ratingvalue" min=0 value=3.5 max=5>rated 3.5/5</meter> (based on <span itemprop="reviewcount">11</span> customer reviews) </div> </div> similarly, for date- and time-related data, the time element and its datetime attribute can be used.
... an item with one property, "birthday", whose value is a date <div itemscope> i was born on <time itemprop="birthday" datetime="2009-05-10">may 10th 2009</time>.
...sing the value of the element's data attribute relative to the node document of the element at the time the attribute is set if the element is a data element the value is the value of the element's value attribute if the element is a meter element the value is the value of the element's value attribute if the element is a time element the value is the element's datetime value otherwise the value is the element's textcontent.
...And 2 more matches
Evolution of HTTP - HTTP
at this point, a typical request and response looked like this: get /mypage.html http/1.0 user-agent: ncsa_mosaic/2.0 (windows 3.1) 200 ok date: tue, 15 nov 1994 08:12:31 gmt server: cern/3.0 libwww/2.17 content-type: text/html <html> a page with an image <img src="/myimage.gif"> </html> followed by a second connection and request to fetch the image (followed by a response to that request): get /myimage.gif http/1.0 user-agent: ncsa_mosaic/2.0 (windows 3.1) 200 ok date: tue, 15 nov 1994 08:12:32 gmt server: cern/3.0 libwww/2.17 con...
...la.org user-agent: mozilla/5.0 (macintosh; intel mac os x 10.9; rv:50.0) gecko/20100101 firefox/50.0 accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8 accept-language: en-us,en;q=0.5 accept-encoding: gzip, deflate, br referer: https://developer.mozilla.org/docs/glossary/simple_header 200 ok connection: keep-alive content-encoding: gzip content-type: text/html; charset=utf-8 date: wed, 20 jul 2016 10:55:30 gmt etag: "547fa7e369ef56031dd3bff2ace9fc0832eb251a" keep-alive: timeout=5, max=1000 last-modified: tue, 19 jul 2016 00:59:33 gmt server: apache transfer-encoding: chunked vary: cookie, accept-encoding (content) get /static/img/header-background.png http/1.1 host: developer.cdn.mozilla.net user-agent: mozilla/5.0 (macintosh; intel mac os x 10.9; rv:50.0) gecko/201001...
...01 firefox/50.0 accept: */* accept-language: en-us,en;q=0.5 accept-encoding: gzip, deflate, br referer: https://developer.mozilla.org/docs/glossary/simple_header 200 ok age: 9578461 cache-control: public, max-age=315360000 connection: keep-alive content-length: 3077 content-type: image/png date: thu, 31 mar 2016 13:34:46 gmt last-modified: wed, 21 oct 2015 18:27:50 gmt server: apache (image content of 3077 bytes) http/1.1 was first published as rfc 2068 in january 1997.
...And 2 more matches
Browser detection using the user agent - HTTP
another such case is for fixing bugs in browsers that do not automatically update.
...webkit is a bit worse because apple forces all of the browsers on ios to use webkit internally, thus the user has no way to get a better more updated browser on older devices.
... var ua=navigator.useragent, iswebkit=/\b(ipad|iphone|ipod)\b/.test(ua) && /webkit/.test(ua) && !/edge/.test(ua) && !window.msstream; var mediaqueryupdated = true, mql = []; function whenmediachanges(){mediaqueryupdated = true} var listentomediaquery = iswebkit ?
...And 2 more matches
Cross-Origin Resource Sharing (CORS) - HTTP
WebHTTPCORS
additionally, for http request methods that can cause side-effects on server data (in particular, http methods other than get, or post with certain mime types), the specification mandates that browsers "preflight" the request, soliciting supported methods from the server with the http options request method, and then, upon "approval" from the server, sending the actual request.
... http/1.1 200 ok date: mon, 01 dec 2008 00:23:53 gmt server: apache/2 access-control-allow-origin: * keep-alive: timeout=2, max=100 connection: keep-alive transfer-encoding: chunked content-type: application/xml […xml data…] in response, the server sends back an access-control-allow-origin header.
... user-agent: mozilla/5.0 (macintosh; intel mac os x 10.14; rv:71.0) gecko/20100101 firefox/71.0 accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8 accept-language: en-us,en;q=0.5 accept-encoding: gzip,deflate connection: keep-alive origin: http://foo.example access-control-request-method: post access-control-request-headers: x-pingother, content-type http/1.1 204 no content date: mon, 01 dec 2008 01:15:39 gmt server: apache/2 access-control-allow-origin: https://foo.example access-control-allow-methods: post, get, options access-control-allow-headers: x-pingother, content-type access-control-max-age: 86400 vary: accept-encoding, origin keep-alive: timeout=2, max=100 connection: keep-alive once the preflight request is complete, the real request is sent: post /doc http...
...And 2 more matches
Set-Cookie - HTTP
header type response header forbidden header name no forbidden response-header name yes syntax set-cookie: <cookie-name>=<cookie-value> set-cookie: <cookie-name>=<cookie-value>; expires=<date> set-cookie: <cookie-name>=<cookie-value>; max-age=<non-zero-digit> set-cookie: <cookie-name>=<cookie-value>; domain=<domain-value> set-cookie: <cookie-name>=<cookie-value>; path=<path-value> set-cookie: <cookie-name>=<cookie-value>; secure set-cookie: <cookie-name>=<cookie-value>; httponly set-cookie: <cookie-name>=<cookie-value>; samesite=strict set-cookie: <cookie-name>=<cookie-value>; samesi...
... expires=<date> optional the maximum lifetime of the cookie as an http-date timestamp.
... see date for the required formatting.
...And 2 more matches
Text formatting - JavaScript
internationalization the intl object is the namespace for the ecmascript internationalization api, which provides language sensitive string comparison, number formatting, and date and time formatting.
... the constructors for collator, numberformat, and datetimeformat objects are properties of the intl object.
... date and time formatting the datetimeformat object is useful for formatting date and time.
...And 2 more matches
SDK API Lifecycle - Archive of obsolete content
it has two main components: a stability index that defines how stable each module is a deprecation process that defines when and how stable sdk apis can be changed or removed from future versions of the sdk while giving developers enough time to update their code.
... deprecation process deprecation in the chosen release, the sdk team will communicate the module's deprecation: update the module's stability index to be "deprecated" include a deprecation notice in the release notes, the add-ons blog, and the jetpack google group.
... removal the target removal date is 18 weeks after deprecation.
... in preparation for this date the sdk team will decide whether to go ahead with removal: this will depend on how many developers have successfully migrated from the deprecated module, and on how urgently the module needs to be removed.
Creating Reusable Modules - Archive of obsolete content
.createinstance(ci.nsilocalfile); f.initwithpath(path); var istream = cc["@mozilla.org/network/file-input-stream;1"] .createinstance(ci.nsifileinputstream); // open for reading istream.init(f, 0x01, 0444, 0); var ch = cc["@mozilla.org/security/hash;1"] .createinstance(ci.nsicryptohash); // we want to use the md5 algorithm ch.init(ch.md5); // this tells updatefromstream to read the entire file const pr_uint32_max = 0xffffffff; ch.updatefromstream(istream, pr_uint32_max); // pass false here to get binary data back var hash = ch.finish(false); // convert the binary hash data to a hex string.
....createinstance(ci.nsilocalfile); f.initwithpath(path); var istream = cc["@mozilla.org/network/file-input-stream;1"] .createinstance(ci.nsifileinputstream); // open for reading istream.init(f, 0x01, 0444, 0); var ch = cc["@mozilla.org/security/hash;1"] .createinstance(ci.nsicryptohash); // we want to use the md5 algorithm ch.init(ch.md5); // this tells updatefromstream to read the entire file const pr_uint32_max = 0xffffffff; ch.updatefromstream(istream, pr_uint32_max); // pass false here to get binary data back var hash = ch.finish(false); // convert the binary hash data to a hex string.
....createinstance(ci.nsilocalfile); f.initwithpath(path); var istream = cc["@mozilla.org/network/file-input-stream;1"] .createinstance(ci.nsifileinputstream); // open for reading istream.init(f, 0x01, 0444, 0); var ch = cc["@mozilla.org/security/hash;1"] .createinstance(ci.nsicryptohash); // we want to use the md5 algorithm ch.init(ch.md5); // this tells updatefromstream to read the entire file const pr_uint32_max = 0xffffffff; ch.updatefromstream(istream, pr_uint32_max); // pass false here to get binary data back var hash = ch.finish(false); // convert the binary hash data to a hex string.
... var s = array.from(hash, (c, i) => tohexstring(hash.charcodeat(i))).join(""); return s; } exports.hashfile = md5file; index.js finally, update index.js to import these two new modules and use them: var filepicker = require("./filepicker.js"); var md5 = require("./md5.js"); require("sdk/ui/button/action").actionbutton({ id: "show-panel", label: "show panel", icon: { "16": "./icon-16.png" }, onclick: function() { console.log(md5.hashfile(filepicker.promptforfile())); } }); distributing modules with jpm, we use npm as the package manager for sdk modules that don't ship inside firefox.
Localization - Archive of obsolete content
er → everything else russian uses four forms, that can be described as follows: one → n mod 10 is 1 and n mod 100 is not 11; few → n mod 10 in 2..4 and n mod 100 not in 12..14; many → n mod 10 is 0 or n mod 10 in 5..9 or n mod 100 in 11..14; other → everything else plural rules for all languages can be found in the cldr language plural rules page (although this table is out of date compared to the cldr xml source).
... locale updater the locale updater add-on makes it easier to update locale files.
... once you've installed it, open the add-on manager, and you'll see a new button labeled "update l10n" next to each add-on you've installed: click the button and you'll be prompted for a new .properties file for that add-on.
... if you provide a new file, the add-on's locale data will be updated with the new file.
Creating custom Firefox extensions with the Mozilla build system - Archive of obsolete content
if someone can confirm this and/or provide guidelines for what's different, i'll update the article to incorporate this information.
...add the following line at the end of the file: ac_add_options --enable-extensions=default,myextension now launch make from the mozilla root: make -f client.mk build even if you have an up-to-date firefox build, you'll have to wait a while for make to recurse over the entire mozilla source tree looking for new stuff (on my machine, which is pretty fast, this takes a good 10-15 minutes).
...rumor has it that at some future date, this will possible through the nsiextensionmanager interface or something similar.
...the downside is that you will need to update the modified makefile any time a new version of the library is released.
Deploying a Plugin as an Extension - Archive of obsolete content
this feature is particularly useful for vendors who wish to deploy the plugin even if firefox is not currently installed, or who want to use the automatic extension update mechanism to update their plugin to a newer version.
...one of the additional things that can be placed in the install.rdf is called an updateurl.
... for example: <em:updateurl><http://www.rhapsody.com/update.rdf></em:updateurl> this url specifies an rdf file that can be used to tell firefox that there are updates available for your extension.
... this rdf file can be updated to indicate that an update to our extension/plugin is available.
Jetpack Processes - Archive of obsolete content
to prevent such memory leaks, a process can either invalidate a handle, immediately preventing it from being passed as a message argument, or it can unroot the handle, allowing it to be passed as a message argument until all references to it are removed, at which point it is garbage collected.
... handles have the following native methods and properties: invalidate() invalidates the handle.
... either process may invalidate a handle when it is no longer useful.
...oninvalidate a callback to call when the handle is garbage collected, either through an explicit call to invalidate() or being unrooted and then unreachable.
Signing an XPI - Archive of obsolete content
note: these instructions are outdated.
... this article is a mirror of the original, with minor reformatting, some new info and all links updated in march 2010.
...mytestcert u,u,cu certum root ca ct,c,c certum level iii ca c,c,c code signing (certum) u,u,u you should notice that the existing certificate has been updated.
...echo started at %date% %time% > %x%\build.log md build\chrome cd chrome zip -r -0 "%x%.jar" * >> %x%\build.log move "%x%.jar" ..\build\chrome >> %x%\build.log cd ..
Tabbed browser - Archive of obsolete content
note that some http requests aren't associated with a tab; for example, rss feed updates, extension manager requests, xhr requests from xpcom components, etc.
... warning: this code should be updated to use nsiloadcontext instead of getinterface(components.interfaces.nsidomwindow).
... updated example is in section below this observe: function (subject, topic, data) { if (topic == "http-on-modify-request") { subject.queryinterface(components.interfaces.nsihttpchannel); var url = subject.uri.spec; /* url being requested.
...: achannel.loadgroup.notificationcallbacks; if (!notificationcallbacks) return null; var domwin = notificationcallbacks.getinterface(components.interfaces.nsidomwindow); return gbrowser.getbrowserfordocument(domwin.top.document); } catch (e) { dump(e + "\n"); return null; } } getting the browser that fires the http-on-modify-request notification (example code updated for loadcontext) here an example of the previous section is shown.
Index of archived content - Archive of obsolete content
extension developing add-ons displaying web content in an extension without security issues downloading json and javascript in extensions enhanced extension installation extension etiquette extension library extension packaging extension samples extension theming guidelines extension versioning, update and compatibility extensions support in seamonkey 2 firefox addons developer guide hiding browser chrome hotfix extension how to convert an overlay extension to restartless inline options install manifests installing extensions and themes from web pages interaction between privileged and non-privileged pages...
... install script template xpinstall api reference examples file.macalias file.windowsshortcut install.adddirectory install.addfile installtrigger.installchrome installtrigger.startsoftwareupdate trigger scripts and install scripts windows install file object methods install object methods properties ...
... engine extending gecko with xbl and xtf mozilla e4x rich web svg and canvas in mozilla xul - mozilla's xml user interface language xtech 2006 presentations xul explorer xulrunner application update article building xulrunner building xulrunner with python commandline components creating xulrunner apps with the mozilla build system creating a windows inno setup installer for xulrunner applications custom app bundles for mac os x debugging a xulrunner application deploying x...
...ticationinfo npn_getintidentifier npn_getproperty npn_getstringidentifier npn_getstringidentifiers npn_geturl npn_geturlnotify npn_getvalue npn_getvalueforurl npn_hasmethod npn_hasproperty npn_identifierisstring npn_intfromidentifier npn_invalidaterect npn_invalidateregion npn_invoke npn_invokedefault npn_memalloc npn_memflush npn_memfree npn_pluginthreadasynccall npn_posturl npn_posturlnotify npn_releaseobject npn_releasevariantvalue npn_reloadplugins npn_removeproperty npn_...
Localizing an extension - Archive of obsolete content
the stockwatcher2.dtd file contains the mappings for the stockwatcher2.xul file: <!entity panel_loading "loading..."> <!entity menu_refresh_now.label "refresh now"> <!entity menu_apple.label "apple (aapl)"> <!entity menu_google.label "google (goog)"> <!entity menu_microsoft.label "microsoft (msft)"> <!entity menu_yahoo.label "yahoo (yhoo)"> update the xul files each xul file needs to reference its corresponding locale file.
... we also need to update the code to use the entities instead of the strings, so that the substitutions take place based on the currently active locale.
...update the chrome manifest to let firefox know about the locale files, we need to make a revision to our chrome.manifest file, adding one line for each localization: locale stockwatcher2 en-us chrome/locale/ this instructs firefox that the en-us localization is located in the chrome/locale/en-us directory.
...id="myextensionname-filename") update the javascript code now we're ready to revise the javascript code to load the strings from the string bundle instead of using literal strings.
Developing New Mozilla Features - Archive of obsolete content
warning: the content of this article may be out of date.
... it was last updated in 2004.
... if you’ve got a large patch, let the likely reviewers know when they might expect to see it if your timeframe is tight, check out the mozilla roadmap for milestone dates and see if your feature will arrive at a time of furious activity.
... original document information author(s): mitchell baker last updated date: october 30, 2004 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
JavaScript crypto - Archive of obsolete content
avoid using it and update existing code if possible; see the compatibility table at the bottom of this page to guide your decision.
...d checked against a pre-installed certificate copy in the local certificate database) the public keys, wrapped encryption private key, and text string from the script (possibly containing naming or enrollment info) are signed by the user signed blob is returned to the script script submits signed blob and any other necessary info to the ca/ra ca/ra verifies signature on signed blob ca/ra validates identity of user ca/ra sends wrapped encryption private key to kra kra sends escrow verification back to ca ca creates and signs certificates ca sends certificates back to the user (importusercertificates) typical use the ca's enrollment page could look something like this: <!doctype html> <h2>request a cert</h2> <form name="reqform" method="post" action="http://your.ra.site.org"> <p><in...
...en name=cert_request value=""> <p>name: <input type=text name=name value=""> <p>password: <input type=password name="password" value=""> <p><input type=submit name="send" value="submit"> </form> <script> /* the following values could be filled in by the server cgi */ var authenticator = "server_magic"; var keytransportcert = null; var crmfobject = null; var form = document.forms[0]; function validate() { // generate keys for nsm.
...peof(crypto.version) != "undefined") { crmfobject = crypto.generatecrmfrequest( "cn=" + form.name.value, form.password.value, authenticator, keytransportcert, "setcrmfrequest();", 1024, null, "rsa-dual-use"); } return false; } function setcrmfrequest() { form.cert_request.value = crmfobject.request; form.submit(); } form.onsubmit = validate; </script> on completion of the request, the ca may submit a page that looks something like this: <!doctype html> <h2>certificate request successful</h2> <p>hit 'load' to load your certificate</p> <form name="reqform"> <p><input type=submit name="load" value="submit"></p> </form> <script> /* the following values could be filled in by the server cgi */ var nickname= "mycertnickname"; var cert =...
Twitter - Archive of obsolete content
for example, the twitter method for tweeting, statuses/update, maps to jetpack.lib.twitter.statuses.update().
...example: jetpack.lib.twitter.statuses.update({ data: { status: "o frabjous day!" }, username: "basic_auth_username", password: "basic_auth_password", success: function () console.log("hey!") }); user authentication you can supply a username and password to methods that require authentication using the second, more advanced call style described above.
...when you call a method that requires authentication -- such as jetpack.lib.twitter.statuses.update() -- without providing a username or password, firefox will prompt the user for them if she is not already authenticated with twitter.
... example usage tweeting jetpack.lib.twitter.statuses.update({ status: "o frabjous day!" }); firefox will prompt for a username and password if the user is not already authenticated with twitter.
Menu - Archive of obsolete content
ArchiveMozillaJetpackUIMenu
null is recommended because it stands out.) function a menuitem that will update itself when its menu is shown.
...examples before running any examples, import the api from the future: jetpack.future.import("menu"); snippets add a single, static menuitem to the jetpack menu that doesn't do anything: jetpack.menu.add("two drink holders and a captain's chair"); add a menuitem to the jetpack menu that displays the current date and time each time it's opened: jetpack.menu.add(function () new date().tostring()); click an item in the jetpack menu to be notified of the current date and time: jetpack.menu.add({ label: "show current date and time", command: function () jetpack.notifications.show(new date()) }); the same, except on the content context menu: jetpack.menu.context.page.add({ label: "show current date and...
... time", command: function () jetpack.notifications.show(new date()) }); create a submenu within the content context menu.
...p://example.com/ice-cream.png", menu: new jetpack.menu(["vanilla", "chocolate", "pistachio", null, "none"]), command: function (menuitem) jetpack.notifications.show(menuitem.label) }); add an item to the hyperlink context menu that tweets the link: jetpack.menu.context.page.on("a").add(function (context) { return { label: "tweet", command: function () jetpack.lib.twitter.statuses.update({ status: context.node.href }) }; )); add an item to the page's context menu depending on some complex criteria that can't be completely expressed via a css selector: jetpack.menu.context.page.beforeshow = function (menu, context) { menu.reset(); if (matchesmycriteria(context)) menu.add("match!"); }; add an item to both the hyperlink context menu and the image context menu: ...
Simple Storage - Archive of obsolete content
jetpack.storage.simple.notes = jetpack.storage.simple.notes || []; var notes = jetpack.storage.simple.notes; // updates the jetpack menu with the current notes.
...function updatejetpackmenu() { jetpack.menu.set({ label: "notes", menu: new jetpack.menu(notes.length > 0 ?
...:( jetpack.menu.context.page.beforeshow = function (menu) { menu.reset(); if (jetpack.selection.text) menu.add({ label: "note", command: function () { notes.unshift(jetpack.selection.text); if (notes.length > 20) notes.pop(); updatejetpackmenu(); } }); }; // initialize the jetpack menu with the current notes.
... updatejetpackmenu(); see also settings jep 11 ...
Modularization techniques - Archive of obsolete content
warning: the content of this article may be out of date.
... it was last updated in 2004.
...this sample code should be updated to reflect this, but it gives you a good basic understanding of com from the c++ perspective.
... links the component object model specification revision history feb 25, 1998, created oct 19, 1998, dusted off momentarily oct 10, 1999, added comments about xpidl, language-independentness original document information author(s): will scullin last updated date: september 13, 2004 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details ...
Mozilla Application Framework in Detail - Archive of obsolete content
in addition, independent software developers and corporate information technology departments now have complete access to the modular source code and freedom to freely license the source, make changes and build customized versions to accommodate their individual needs.
...xpinstall makes it easy to write both simple installation scripts and complex installations that check versions, log installation data to the local system, execute other installers, and update the appropriate registry settings.
...the mozblog application hosted at mozdev.org, for example, uses xpinstall to make several different versions available simultaneously as updates are made and the browser itself advances versions.
... original document information author(s): myk melez, ian oeschger original document: http://www.mozilla.org/why/framework-details.html last updated date: february 15, 2006 copyright information: copyright (c) myk melez, ian oeschger ...
Space Manager High Level Design - Archive of obsolete content
during reflow, the space manager stores the space taken up by floats (updatespacemanager in nsblockframe) and provides information about the space available for other elements (getavailablespace in nsblockreflowstate).
...this happens in the method nsblockreflowstate::recoverfloats and nsblockreflowstate::flowandplacefloat (formerly this was done in nsblockframe::updatespacemanager).
... if the block has any block children, then translate the space manager to the child block's origin and update the space manager in the context for the child block, recursively.
...e) nsblockframe::paint is mucking with nsblockbanddata in and #if 0 block - remove that and the include (compiles fine) nsspacemanger has no way of clearing the float damage interval set - this might be needed if the spacemanager persists beyond a reflow original document information author(s): marc attinasi other contributors: alex savulov, chris waterson, david baron, josh soref last updated date: november 20, 2005 ...
The life of an HTML HTTP request - Archive of obsolete content
warning: the content of this article may be out of date.
... it was last updated in 1999.
...this is used to create and update the nsiframe hierarchy.
... original document information author(s): alexander larsson last updated date: october 8, 1999 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Learn XPI Installer Scripting by Example - Archive of obsolete content
mozilla cross-platform installations use the xpi format as a way to organize, compress, and automate software installations and software updates.
... adding files and directories (full of files) to the install once you have verified that the target can accomodate the software to be installed and initialized the actual installation, you must add files and directories to the installation in order to have them installed.
... minimally, the installation script must: call initinstall with the name and version of the executable (the version is not optional, though you may or may not use the version in subsequent installations or updates) find somewhere to put the installed files.
... original document information author(s): ian oeschger last updated date: 01/26/2006 copyright information: copyright (c) ian oeschger ...
Broadcasters and Observers - Archive of obsolete content
in the latter case, various user interface elements might need to update when the user switches from offline mode to online mode.
...if the value of the label attribute on the broadcaster changes, the observers will update the values of their label attributes also.
...whenever the value of any of the attributes on the broadcaster changes, the observers are all notified and they update their own attributes to match.
...the only attributes that are not updated are the id and persist attributes; these attributes are never shared.
Tree View Details - Archive of obsolete content
the view should then perform any necessary operations to retrieve the child rows and then update the tree with the new rows.
...ecount); this.treebox.rowcountchanged(idx + 1, -deletecount); } } else { item[2] = true; var label = this.visibledata[idx][0]; var toinsert = this.childdata[label]; for (var i = 0; i < toinsert.length; i++) { this.visibledata.splice(idx + i + 1, 0, [toinsert[i], false]); } this.treebox.rowcountchanged(idx + 1, toinsert.length); } this.treebox.invalidaterow(idx); } first we will need to check if the row is a container.
...the easiest way to do this is to invalidate the row.
...box.rowcountchanged(idx + 1, -deletecount); } } else { item[2] = true; var label = this.visibledata[idx][0]; var toinsert = this.childdata[label]; for (var i = 0; i < toinsert.length; i++) { this.visibledata.splice(idx + i + 1, 0, [toinsert[i], false]); } this.treebox.rowcountchanged(idx + 1, toinsert.length); } this.treebox.invalidaterow(idx); }, getimagesrc: function(idx, column) {}, getprogressmode : function(idx,column) {}, getcellvalue: function(idx, column) {}, cycleheader: function(col, elem) {}, selectionchanged: function() {}, cyclecell: function(idx, column) {}, performaction: function(action) {}, performactiononcell: function(action, index, column) {}, getrowproperties: function(idx, prop) {}, ...
XUL controls - Archive of obsolete content
<colorpicker type="button" color="#cc0080"/> colorpicker reference <datepicker> a set of textboxes which may be used to allow the entry of a date.
... <datepicker value="2007/03/26"/> datepicker reference <datepicker type="grid"> a datepicker which displays a calendar grid for selecting a date.
... <datepicker type="grid" value="2007/02/20"/> datepicker reference <datepicker type="popup" > a datepicker which displays a set of textboxes for date entry, but also has a button for displaying a popup calendar grid.
... <datepicker type="popup" value="2008/08/24"/> datepicker reference <description> the description element is used for descriptive text.
XULRunner Hall of Fame - Archive of obsolete content
version updates match the rapid release cycle.
...source yoono desktop win/mac application to get all your friend updates, update your status and share stuff easily across facebook, myspace, twitter, and more - all at once!
... inactive projects these projects appear to be less actively developed, with no updates since 2010.
...an updated version of "mybrowser" that works with firefox 25.0.1+ is available in matthew kastor's xulrunner examples at https://github.com/matthewkastor/xulrunner-examples/ exch a currency conversion tool using updated data from http://finance.yahoo.com/currency.
Extentsions FAQ - Archive of obsolete content
you must remove updateurl from the install.rdf and use a known to amo minversion/maxversion.
...however not all servers support user flags, in which case you get reduced functionality as follows: all flags are stored in your local cache and are lost if your cache gets invalidated, and only "known" properties are copied when messages are copied.
... friday, september 29 - october 6, 2006 (↑ top) how can we programmatically extract the subject, sender, date and the body of an e- mail when you are reading one (in thunderbird presumably)?
... friday, october 6 - 13, 2006 (↑ top) has anyone experienced problem with update that it only considers themes and extensions during the update check, ignoring langpacks with firefox 2.0?
2006-10-06 - Archive of obsolete content
test resumt will be found here another lightning localization update with some bad news difference has been located between sunbird_0_3_branch (for sunbird 0.3) and mozilla_1_8_branch.
... sunbird/lightning localization update you need to update your localization if you want your locale to ship with lightning 0.3 or sunbird 0.3.
... calendar localization update rc1 for sunbird 0.3 is out now and ready for testing.
... discussions status update fx2 status update for firefox 2.
2006-12-01 - Archive of obsolete content
firefox 1.5.0.9/2.0.0.1 update - we need help!
... jay patael calls for help getting the next update ff 1.5.x and 2.x.
... automatic configure updated back preed announces that the machine that does the automatic autoconf/configure generation (egg.build.mozilla.org) is back up.
...watch #grandparadiso for updates.
NPClass - Archive of obsolete content
syntax struct npclass { uint32_t structversion; npallocatefunctionptr allocate; npdeallocatefunctionptr deallocate; npinvalidatefunctionptr invalidate; nphasmethodfunctionptr hasmethod; npinvokefunctionptr invoke; npinvokedefaultfunctionptr invokedefault; nphaspropertyfunctionptr hasproperty; npgetpropertyfunctionptr getproperty; npsetpropertyfunctionptr setproperty; npremovepropertyfunctionptr removeproperty; npenumerationfunctionptr enumerate; npconstructfunctionptr construct; }; warning: don't call these routines directly.
... invalidate called on live objects that belong to a plugin instance that is being destroyed.
...any attempt to use an invalidated object will result in undefined behavior.
... function pointer syntax typedef npobject *(*npallocatefunctionptr)(npp npp, npclass *aclass); typedef void (*npdeallocatefunctionptr)(npobject *npobj); typedef void (*npinvalidatefunctionptr)(npobject *npobj); typedef bool (*nphasmethodfunctionptr)(npobject *npobj, npidentifier name); typedef bool (*npinvokefunctionptr)(npobject *npobj, npidentifier name, const npvariant *args, uint32_t argcount, npvariant *result); typedef bool (*npinvokedefaultfunctionptr)(npobject *npobj, ...
Shipping a plugin as a Toolkit bundle - Archive of obsolete content
providing updates when plugins are packaged in this way they can make use of the built in add-on update system.
... this allows a remote update file to be read periodically and an updated version of the plugin offered to the user or to mark the plugin as compatible with a wider range of applications.
... this is performed by including an updateurl in the install manifest.
... this should point to an update.rdf file on the internet which will include the updated versions and version information for the plugin.
Building a Theme - Archive of obsolete content
introduction this tutorial will take you through the steps required to build a very basic theme - one which updates the background color of the toolbars in firefox.
... for this tutorial, we're going to update the background color of the toolbars.
... you can now go back and make additional changes to your css files, close and restart firefox, and see the updates.
... on mac os or linux, you can use the command-line zip tool: zip -r my_theme.xpi install.rdf chrome.manifest browser communicator global mozapps or, if you have 7-zip installed, you can use that for zipping it up: 7z a -tzip my_theme.xpi chrome chrome.manifest note: the command-line tool will update an existing zip file, not replace it - so if you have files you've deleted from your theme, be sure to remove the .xpi file before running the zip command again.
Archived JavaScript Reference - Archive of obsolete content
it's equivalent to object.observe() invoked with the accept type list ["add", "update", "delete", "splice"].
...this operation leaves oldbuffer in a detached state.date.prototype.tolocaleformat()the non-standard tolocaleformat() method converts a date to a string using the specified formatting.
... intl.datetimeformat is an alternative to format dates in a standards-compliant way.
... see also the newer version of date.prototype.tolocaledatestring().ecmascript 2016 to es.next support in mozillaexpression closuresexpression closures are a shorthand function syntax for writing simple functions.for each...inthe for each...in statement iterates a specified variable over all values of object's properties.
Bounding volume collision detection with THREE.js - Game development
so if we apply transformations or change the position of the mesh, we need to manually update the bounding sphere.
... the advantages of using this helper are: it has an update() method that will resize its bounding box mesh if the linked mesh rotates or changes its dimensions, and update its position.
...we need to call the update() method so the boxhelper instance matches its linked mesh.
... knot.position.set(-3, 2, 1); knot.rotation.x = -math.pi / 4; // update the bounding box so it stills wraps the knot knotboxhelper.update(); box3.setfromobject(knotboxhelper); performing collision tests is done in the same way as explained in the above section — we use our box3 object in the same way as described above.
Implementing game control mechanisms - Game development
every state has its own default methods: preload(), create(), and update().
... the first one is needed for preloading required assets, create() is executed once the state had started, and update() is executed on every frame.
...} it will be created once at the start of the game, and will execute this.clickenclave() action assigned to it when clicked, but you can also use the mouse's pointer value in the update() function to make an action: update: function() { // ...
...we'll be playing mostly with the mainmenu.js and game.js files, and we'll explain the code inside the create() and update() methods in much more detail in later articles.
Move the ball - Game development
now, let's draw the ball — add the following inside your draw() function: ctx.beginpath(); ctx.arc(50, 50, 10, 0, math.pi*2); ctx.fillstyle = "#0095dd"; ctx.fill(); ctx.closepath(); try your updated code now — the ball should be repainted on every frame.
... first, add the following two lines above your draw() function, to define x and y: var x = canvas.width/2; var y = canvas.height-30; next update the draw() function to use the x and y variables in the arc() method, as shown in the following highlighted line: function draw() { ctx.beginpath(); ctx.arc(x, y, 10, 0, math.pi*2); ctx.fillstyle = "#0095dd"; ctx.fill(); ctx.closepath(); } now comes the important part: we want to add a small value to x and y after every frame has been drawn to make it appear that the ball i...
...add the following below your x and y variable definitions: var dx = 2; var dy = -2; the last thing to do is to update x and y with our dx and dy variable on every frame, so the ball will be painted in the new position on every update.
...every 10 milliseconds the canvas is cleared, the blue circle (our ball) will be drawn on a given position and the x and y values will be updated for the next frame.
Initialize the framework - Game development
, and add the following code to it: <!doctype html> <html> <head> <meta charset="utf-8" /> <title>gamedev phaser workshop - lesson 01: initialize the framework</title> <style>* { padding: 0; margin: 0; }</style> <script src="js/phaser.min.js"></script> </head> <body> <script> var game = new phaser.game(480, 320, phaser.canvas, null, { preload: preload, create: create, update: update }); function preload() {} function create() {} function update() {} </script> </body> </html> downloading the phaser code next, we need to go through the process of downloading the phaser source code and applying it to our html document.
... update the src value of the first <script> element as shown above.
... the id of the <canvas> to use for rendering if one already exists on the page (we've specified null because we want phaser to create its own.) the names to use for phaser's three key functions that load and start the game, and update the game loop on every frame; we will use the same names to keep it clean.
... preload takes care of preloading the assets create is executed once when everything is loaded and ready update is executed on every frame.
Player paddle and controls - Game development
to enable collision detection between the paddle and ball, add the collide() method to the update() function as shown: function update() { game.physics.arcade.collide(ball, paddle); } the first parameter is one of the objects we are interested in — the ball — and the second is the other one, the paddle.
...add the following new line to the update() function, as shown: function update() { game.physics.arcade.collide(ball, paddle); paddle.x = game.input.x; } now on every new frame the paddle's x position will adjust accordingly to the input's x position, however when we start the game, the position of the paddle is not in the middle.
...update the previous line as follows: paddle.x = game.input.x || game.world.width*0.5; if you haven't already done so, reload your index.html and try it out!
...) line and update it to the following: ball.body.velocity.set(150, -150); now the ball will start right from the middle of the paddle.
Build your own function - Learn web development
first of all, update the first line of the function: function displaymessage() { to this: function displaymessage(msgtext, msgtype) { now when we call the function, we can provide two variable values inside the parentheses to specify the message to display in the message box, and the type of message it is.
... to make use of the first parameter, update the following line inside your function: msg.textcontent = 'this is a message box'; to msg.textcontent = msgtext; last but not least, you now need to update your function call to include some updated message text.
...first, update the .msgbox width from: width: 200px; to width: 242px; next, add the following lines inside the .msgbox p { ...
... let's test out our updated function, try updating the displaymessage() call from this: displaymessage('woo, this is a different message!'); to one of these: displaymessage('your inbox is almost full — delete some mails', 'warning'); displaymessage('brian: hi there, how are you today?','chat'); you can see how useful our (now not so) little function is becoming.
Introduction to web APIs - Learn web development
apis that fetch data from the server to update small sections of a webpage on their own are very commonly used.
... this seemingly small detail has had a huge impact on the performance and behaviour of sites — if you just need to update a stock listing or list of available new stories, doing it instantly without having to reload the whole entire page from the server can make the site or app feel much more responsive and "snappy".
... apis for drawing and manipulating graphics are now widely supported in browsers — the most popular ones are canvas and webgl, which allow you to programmatically update the pixel data contained in an html <canvas> element to create 2d and 3d scenes.
...examples include telling the user that a useful update is available on a web app via system notifications (see the notifications api) or vibration hardware (see the vibration api).
Ember app structure and componentization - Learn web development
update the application.hbs file again so its content looks like this: <section class="todoapp"> <h1>todos</h1> <input class="new-todo" aria-label="what needs to be done?" placeholder="what needs to be done?" autofocus > <section class="main"> <input id="mark-all-complete" class="toggle-all" type="checkbox"> <label for="mark-all-complete">mark all as complete</label> ...
... the header.hbs file should be updated to contain the following: <input class="new-todo" aria-label="what needs to be done?" placeholder="what needs to be done?" autofocus > todo-list.hbs should be updated to contain this chunk of code: <section class="main"> <input id="mark-all-complete" class="toggle-all" type="checkbox"> <label for="mark-all-complete">mark all as complete</label> <ul class="todo-list"> ...
...into the todo.hbs file: <li> <div class="view"> <input aria-label="toggle the completion of this todo" class="toggle" type="checkbox" > <label>buy movie tickets</label> <button type="button" class="destroy" title="remove this todo" ></button> </div> <input autofocus class="edit" value="todo text"> </li> footer.hbs should be updated to contain the following: <footer class="footer"> <span class="todo-count"> <strong>0</strong> todos left </span> <ul class="filters"> <li> <a href="#">all</a> <a href="#">active</a> <a href="#">completed</a> </li> </ul> <button type="button" class="clear-completed"> clear completed </button> </footer> finally, the contents of application.
...hbs should be updated so that they call the appropriate components, like so: <section class="todoapp"> <h1>todos</h1> <header /> <todolist /> <footer /> </section> with these changes made, run npm start in your terminal again, then head over to http://localhost:4200 to ensure that the todo app still looks as it did before the refactor.
Accessibility in React - Learn web development
the textbox <input> in your editing template should be updated like this: <input id={props.id} classname="todo-text" type="text" value={newname} onchange={handlechange} ref={editfieldref} /> the "edit" button in your view template should read like this: <button type="button" classname="btn" onclick={() => setediting(true)} ref={editbuttonref} > edit <span classname="visually-hidden">{props.name}</span> </button> focusing on our ref...
... update your existing useeffect() hook so that it reads like this: useeffect(() => { if (isediting) { editfieldref.current.focus(); } }, [isediting]); these changes make it so that, if isediting is true, react reads the current value of the editfieldref and moves browser focus to it.
...let's try it now — update your useeffect() call like so: useeffect(() => { if (isediting) { editfieldref.current.focus(); } else { editbuttonref.current.focus(); } }, [isediting]); this kind of mostly works.
...we want this constant to track the previous value of isediting, so we call useprevious with isediting as an argument: const wasediting = useprevious(isediting); with this constant, we can update our useeffect() hook to implement the pseudocode we discussed before — update it as follows: useeffect(() => { if (!wasediting && isediting) { editfieldref.current.focus(); } if (wasediting && !isediting) { editbuttonref.current.focus(); } }, [wasediting, isediting]); note that the logic of useeffect() now depends on wasediting, so we provide it in the array of dependencies.
Styling Vue components with CSS - Learn web development
update your app.vue file’s <style> element so it looks like so: <style> /* global styles */ .btn { padding: 0.8rem 1rem 0.7rem; border: 0.2rem solid #4d4d4d; cursor: pointer; text-transform: capitalize; } .btn__danger { color: #fff; background-color: #ca3c3c; border-color: #bd2130; } .btn__filter { border-color: lightgrey; } .btn__danger:focus { outline-color: #c82333; } .btn__prima...
... update your todoform template so that it looks like this: <template> <form @submit.prevent="onsubmit"> <h2 class="label-wrapper"> <label for="new-todo-input" class="label__lg"> what needs to be done?
... update it as follows: <ul aria-labelledby="list-summary" class="stack-large"> adding scoped styles the last component we want to style is our todoitem component.
...the updated template is below: the app should now have custom checkboxes.
Understanding client-side JavaScript frameworks - Learn web development
here we'll get the todo counter to update to show the correct number of todos still to complete, and correctly apply styling to completed todos (i.e.
...to do this, we will take advantage of vue's conditional rendering capabilities — namely v-if and v-else — to allow us to toggle between the existing todo item view and an edit view where you can update todo item labels.
...we'll componentize our app, then add more functionality to allow users to update existing components.
...that list would be very difficult to keep up-to-date anyway, as new ones appear all the time.
Introducing a complete toolchain - Learn web development
however, bear in mind that if you want to refine and enforce a rule about how your code looks (or validates), it's very likely that it can be done with the right eslint configuration.
... parcel also installs the dependencies that we will use in our code, including react, react-dom, react-async-hook, date-fns, and format-number.
... another clever trick parcel has up its sleeve is that any changes to your source code will now trigger an update in the browser.
...you’ll notice that the browser has automatically refreshed, and the line “<date> there will be <number> near misses” at the top of the page has been changed!
Client-side tooling overview - Learn web development
if you are using the npm package manager to manage your dependencies for example, it is a good idea to go to the npm homepage and search for the type of tool you are looking for, for example try searching for "date" if you want a date formating utility, or "formatter" if you are searching for a general code formatter.
... pay attention to the popularity, quality, and maintenance scores, and how recently the package was last updated.
...based on these criteria, the date-fns library looks like a good date formatting tool to use.
...the date-fns docs for example are pretty good, complete, and easy to follow.
Index
685 obsolete add-ons, archive, look & feel, obsolete, themes this page contains theme documents and resources that we don't expect will ever be updated, but which we're keeping for the time being as potential source material for updated docs.
... 689 updates firefox supports automated updates to add-ons using json update manifests.
... add-ons hosted on amo automatically receive updates to new versions posted there.
... other add-ons must specify the location of their update manifests.
Add-on Manager
finding updates add-ons can be checked for updates using the findupdates() method.
... it must be passed an updatelistener to receive information about compatibility information and new update information.
... any available update is returned as an addoninstall which is ready to be downloaded and installed.
...the getstartupchanges() method lets you find out which add-ons were installed, removed, updated, enabled, or disabled at application startup.
Download
this value starts at zero, and may be updated regardless of the value of hasprogress.
... you should use the individual state properties instead, since this value may not be updated after the last piece of data is transferred.
... starttime read only date indicates the start time of the download.
... when the download starts, this property is set to a valid date object.
Release phase
if you haven't already cloned the remote repository, enter this command: hg clone ssh://hg.mozilla.org/releases/l10n-central/x-testing mercurial will let you know that it's cloning the repository: destination directory: x-testing requesting all changes adding changesets adding manifests adding file changes added 4 changesets with 242 changes to 239 files updating to branch default 239 files updated, 0 files merged, 0 files removed, 0 files unresolved the default push url is the same as the default pull url (i.e., ssh://hg.mozilla.org/releases/l10n-central/x-testing).
...here's how that's done: run this command to see recent commits in your local clone: $ hg log -l 3 you should a list of the most recent commits, similar to this one: changeset: 0:7c543e8f3a6a tag: tip user: your name <email@example.com> date: mon nov 23 18:08:25 2009 +0100 summary: added search bar strings now run the hg outgoing command to compare the local repository on your machine with the remote repository on hg.mozilla.org.
...the output will look something like this: comparing with ssh://hg.mozilla.org/releases/l10n-central/x-testing searching for changes changeset: 0:7c543e8f3a6a tag: tip user: your name <email@example.com> date: mon nov 23 18:08:25 2009 +0100 summary: added search bar strings make sure this output is accurate before continuing.
...the merge date for migrating from one product release channel to the next is rapidly approaching.
NSPR Contributor Guide
if several platforms cannot be made to implement your api, then it is not a good candidate for inclusion in nspr.
... before you begin what may be a substantial effort in making a candidate feature for nspr, talk to us.
... we may tell you that you have a good idea; we may say that it really is not a good candidate for inclusion in nspr; we may give you suggestions on what would make it more generalized, hence a good candidate for inclusion in nspr.
... original document information author: reed@reedloden.com last updated date: november 2, 2006 ...
Encrypt Decrypt MAC Keys As Session Objects
null, keysize, keyid, pr_true, pwdata); if (!key) { pr_fprintf(pr_stderr, "symmetric key generation failed \n"); } return key; } /* * macinit */ secstatus macinit(pk11context *ctx) { secstatus rv = pk11_digestbegin(ctx); if (rv != secsuccess) { pr_fprintf(pr_stderr, "compute mac failed : pk11_digestbegin()\n"); } return rv; } /* * macupdate */ secstatus macupdate(pk11context *ctx, unsigned char *msg, unsigned int msglen) { secstatus rv = pk11_digestop(ctx, msg, msglen); if (rv != secsuccess) { pr_fprintf(pr_stderr, "compute mac failed : digestop()\n"); } return rv; } /* * finalize macing */ secstatus macfinal(pk11context *ctx, unsigned char *mac, unsigned int *maclen, unsigned int maxle...
... pr_fprintf(pr_stderr, "compute mac failed : pk11_digestfinal()\n"); } return secsuccess; } /* * compute mac */ secstatus computemac(pk11context *ctxmac, unsigned char *ptext, unsigned int ptextlen, unsigned char *mac, unsigned int *maclen, unsigned int maxlen) { secstatus rv = macinit(ctxmac); if (rv != secsuccess) return rv; rv = macupdate(ctxmac, ptext, ptextlen); if (rv != secsuccess) return rv; rv = macfinal(ctxmac, mac, maclen, maxlen); return rv; } /* * writetoheaderfile */ secstatus writetoheaderfile(const char *buf, unsigned int len, headertype type, prfiledesc *outfile) { secstatus rv; char header[40]; char trailer[40]; char *outstring = null...
...= secsuccess) { pr_fprintf(pr_stderr, "encrypt failure\n"); goto cleanup; } /* save the last block of ciphertext as the next iv */ iv = encbuf; ivlen = encbuflen; /* write the cipher text to intermediate file */ nwritten = pr_write(encfile, encbuf, encbuflen); /*pr_assert(nwritten == encbuflen);*/ rv = macupdate(ctxmac, ptext, ptextlen); } rv = macfinal(ctxmac, mac, &maclen, digestsize); if (rv != secsuccess) { pr_fprintf(pr_stderr, "macfinal failure\n"); goto cleanup; } if (maclen == 0) { pr_fprintf(pr_stderr, "bad mac length\n"); rv = secfailure; goto cleanup; } writetoheaderfile(mac, maclen, mac, headerfile); if (rv != secsuccess...
...ext, sizeof(ctext))) > 0) { count += ctextlen; /* decrypt cipher text buffer using cbc and iv */ rv = decrypt(ctxenc, decbuf, &decbuflen, sizeof(decbuf), ctext, ctextlen); if (rv != secsuccess) { pr_fprintf(pr_stderr, "decrypt failure\n"); goto cleanup; } if (decbuflen == 0) break; rv = macupdate(ctxmac, decbuf, decbuflen); if (rv != secsuccess) { goto cleanup; } if (count == filelength) { decbuflen = decbuflen-paddinglength; } /* write the plain text to out file */ temp = pr_write(outfile, decbuf, decbuflen); if (temp != decbuflen) { pr_fprintf(pr_stderr, "write error\n"); rv = secfailure; br...
Encrypt and decrypt MAC using token
null, keysize, keyid, pr_true, pwdata); if (!key) { pr_fprintf(pr_stderr, "symmetric key generation failed \n"); } return key; } /* * macinit */ secstatus macinit(pk11context *ctx) { secstatus rv = pk11_digestbegin(ctx); if (rv != secsuccess) { pr_fprintf(pr_stderr, "compute mac failed : pk11_digestbegin()\n"); } return rv; } /* * macupdate */ secstatus macupdate(pk11context *ctx, unsigned char *msg, unsigned int msglen) { secstatus rv = pk11_digestop(ctx, msg, msglen); if (rv != secsuccess) { pr_fprintf(pr_stderr, "compute mac failed : digestop()\n"); } return rv; } /* * finalize macing */ secstatus macfinal(pk11context *ctx, unsigned char *mac, unsigned int *maclen, unsigned int maxle...
... pr_fprintf(pr_stderr, "compute mac failed : pk11_digestfinal()\n"); } return secsuccess; } /* * compute mac */ secstatus computemac(pk11context *ctxmac, unsigned char *ptext, unsigned int ptextlen, unsigned char *mac, unsigned int *maclen, unsigned int maxlen) { secstatus rv = macinit(ctxmac); if (rv != secsuccess) return rv; rv = macupdate(ctxmac, ptext, ptextlen); if (rv != secsuccess) return rv; rv = macfinal(ctxmac, mac, maclen, maxlen); return rv; } /* * writetoheaderfile */ secstatus writetoheaderfile(const char *buf, unsigned int len, headertype type, prfiledesc *outfile) { secstatus rv; char header[40]; char trailer[40]; char *outstring = null...
...= secsuccess) { pr_fprintf(pr_stderr, "encrypt failure\n"); goto cleanup; } /* save the last block of ciphertext as the next iv */ iv = encbuf; ivlen = encbuflen; /* write the cipher text to intermediate file */ nwritten = pr_write(encfile, encbuf, encbuflen); /*pr_assert(nwritten == encbuflen);*/ rv = macupdate(ctxmac, ptext, ptextlen); } rv = macfinal(ctxmac, mac, &maclen, digestsize); if (rv != secsuccess) { pr_fprintf(pr_stderr, "macfinal failure\n"); goto cleanup; } if (maclen == 0) { pr_fprintf(pr_stderr, "bad mac length\n"); rv = secfailure; goto cleanup; } writetoheaderfile(mac, maclen, mac, headerfile); if (rv != secsuccess...
...ext, sizeof(ctext))) > 0) { count += ctextlen; /* decrypt cipher text buffer using cbc and iv */ rv = decrypt(ctxenc, decbuf, &decbuflen, sizeof(decbuf), ctext, ctextlen); if (rv != secsuccess) { pr_fprintf(pr_stderr, "decrypt failure\n"); goto cleanup; } if (decbuflen == 0) break; rv = macupdate(ctxmac, decbuf, decbuflen); if (rv != secsuccess) { goto cleanup; } if (count == filelength) { decbuflen = decbuflen-paddinglength; } /* write the plain text to out file */ temp = pr_write(outfile, decbuf, decbuflen); if (temp != decbuflen) { pr_fprintf(pr_stderr, "write error\n"); rv = secfailure; br...
NSS 3.55 release notes
dtls 1.3 implementation is updated to draft-38.
... nspr dependency updated to 4.27.
... bug 1647752 - update dtls 1.3 implementation to draft-38.
... bug 1652331 - update nss 3.55 nspr version to 4.27.
NSS API Guidelines
the preferred format is: "@(#) $rcsfile: nss-guidelines.html, v $ $revision: 48936 $ $date: 2009-08-11 07:45:57 -0700 (tue, 11 aug 2009) $ $name$" you can put the string in a comment or in a static char array.
... here is an example from lib/base/baset.h: #ifdef debug static const char baset_cvs_id[] = "@(#) $rcsfile: nss-guidelines.html, v $ $revision: 48936 $ $date: 2009-08-11 07:45:57 -0700 (tue, 11 aug 2009) $ $name$"; #endif /* debug */ the difference, between this and id, is that id has some useless information (every file is "experimental"), and doesn't have name.
...for instance, in most ssl functions this is the nspr socket, or the ssl socket structure: update, final, encrypt, decrypt type functions operating on their state contexts, etc.
... all hashing update, macing update, and encrypt/decrypt functions which act like filters should have a consistent signature: secstatus pk11_digestop(pk11context *context, unsigned char *inbuf, secbufferleninlen) functions like these which have different properties, for example, additional parameters, callbacks, etc., should insert their additional parameters between th...
Encrypt Decrypt_MAC_Using Token
null, keysize, keyid, pr_true, pwdata); if (!key) { pr_fprintf(pr_stderr, "symmetric key generation failed \n"); } return key; } /* * macinit */ secstatus macinit(pk11context *ctx) { secstatus rv = pk11_digestbegin(ctx); if (rv != secsuccess) { pr_fprintf(pr_stderr, "compute mac failed : pk11_digestbegin()\n"); } return rv; } /* * macupdate */ secstatus macupdate(pk11context *ctx, unsigned char *msg, unsigned int msglen) { secstatus rv = pk11_digestop(ctx, msg, msglen); if (rv != secsuccess) { pr_fprintf(pr_stderr, "compute mac failed : digestop()\n"); } return rv; } /* * finalize macing.
... */ secstatus computemac(pk11context *ctxmac, unsigned char *ptext, unsigned int ptextlen, unsigned char *mac, unsigned int *maclen, unsigned int maxlen) { secstatus rv = macinit(ctxmac); if (rv != secsuccess) return rv; rv = macupdate(ctxmac, ptext, ptextlen); if (rv != secsuccess) return rv; rv = macfinal(ctxmac, mac, maclen, maxlen); return rv; } /* * writetoheaderfile */ secstatus writetoheaderfile(const char *buf, unsigned int len, headertype type, prfiledesc *outfile) { secstatus rv; char header[40]; char trailer[40]; char *outstring = null...
...*/ nwritten = pr_write(encfile, encbuf, encbuflen); /* pr_assert(nwritten == encbuflen); */ rv = macupdate(ctxmac, ptext, ptextlen); } rv = macfinal(ctxmac, mac, &maclen, digestsize); if (rv != secsuccess) { pr_fprintf(pr_stderr, "macfinal failure\n"); goto cleanup; } if (maclen == 0) { pr_fprintf(pr_stderr, "bad mac length\n"); rv = secfailure; goto cleanup; } writetoheaderfile(mac, maclen, mac, headerfile); if (rv != secsuccess...
...*/ rv = decrypt(ctxenc, decbuf, &decbuflen, sizeof(decbuf), ctext, ctextlen); if (rv != secsuccess) { pr_fprintf(pr_stderr, "decrypt failure\n"); goto cleanup; } if (decbuflen == 0) break; rv = macupdate(ctxmac, decbuf, decbuflen); if (rv != secsuccess) { goto cleanup; } if (count == filelength) { decbuflen = decbuflen-paddinglength; } /* write the plain text to out file.
NSS Sample Code Sample_3_Basic Encryption and MACing
null, keysize, keyid, pr_true, pwdata); if (!key) { pr_fprintf(pr_stderr, "symmetric key generation failed \n"); } return key; } /* * macinit */ secstatus macinit(pk11context *ctx) { secstatus rv = pk11_digestbegin(ctx); if (rv != secsuccess) { pr_fprintf(pr_stderr, "compute mac failed : pk11_digestbegin()\n"); } return rv; } /* * macupdate */ secstatus macupdate(pk11context *ctx, unsigned char *msg, unsigned int msglen) { secstatus rv = pk11_digestop(ctx, msg, msglen); if (rv != secsuccess) { pr_fprintf(pr_stderr, "compute mac failed : digestop()\n"); } return rv; } /* * finalize macing */ secstatus macfinal(pk11context *ctx, unsigned char *mac, unsigned int *maclen, unsigned int maxle...
... pr_fprintf(pr_stderr, "compute mac failed : pk11_digestfinal()\n"); } return secsuccess; } /* * compute mac */ secstatus computemac(pk11context *ctxmac, unsigned char *ptext, unsigned int ptextlen, unsigned char *mac, unsigned int *maclen, unsigned int maxlen) { secstatus rv = macinit(ctxmac); if (rv != secsuccess) return rv; rv = macupdate(ctxmac, ptext, ptextlen); if (rv != secsuccess) return rv; rv = macfinal(ctxmac, mac, maclen, maxlen); return rv; } /* * write to header file */ secstatus writetoheaderfile(const char *buf, unsigned int len, headertype type, prfiledesc *outfile) { secstatus rv; char header[40]; char trailer[40]; char *outstring = n...
...= secsuccess) { pr_fprintf(pr_stderr, "encrypt failure\n"); goto cleanup; } /* save the last block of ciphertext as the next iv */ iv = encbuf; ivlen = encbuflen; /* write the cipher text to intermediate file */ nwritten = pr_write(encfile, encbuf, encbuflen); /*pr_assert(nwritten == encbuflen);*/ rv = macupdate(ctxmac, ptext, ptextlen); } rv = macfinal(ctxmac, mac, &maclen, digestsize); if (rv != secsuccess) { pr_fprintf(pr_stderr, "macfinal failure\n"); goto cleanup; } if (maclen == 0) { pr_fprintf(pr_stderr, "bad mac length\n"); rv = secfailure; goto cleanup; } writetoheaderfile(mac, maclen, mac, headerfile); if (rv != secsuccess...
...ext, sizeof(ctext))) > 0) { count += ctextlen; /* decrypt cipher text buffer using cbc and iv */ rv = decrypt(ctxenc, decbuf, &decbuflen, sizeof(decbuf), ctext, ctextlen); if (rv != secsuccess) { pr_fprintf(pr_stderr, "decrypt failure\n"); goto cleanup; } if (decbuflen == 0) break; rv = macupdate(ctxmac, decbuf, decbuflen); if (rv != secsuccess) { goto cleanup; } if (count == filelength) { decbuflen = decbuflen-paddinglength; } /* write the plain text to out file */ temp = pr_write(outfile, decbuf, decbuflen); if (temp != decbuflen) { pr_fprintf(pr_stderr, "write error\n"); rv = secfailure; br...
EncDecMAC using token object - sample 3
the symmetric key */ key = pk11_tokenkeygen(slot, mechanism, null, keysize, keyid, pr_true, pwdata); if (!key) { pr_fprintf(pr_stderr, "symmetric key generation failed \n"); } return key; } /* * macinit */ secstatus macinit(pk11context *ctx) { secstatus rv = pk11_digestbegin(ctx); if (rv != secsuccess) { pr_fprintf(pr_stderr, "compute mac failed : pk11_digestbegin()\n"); } return rv; } /* * macupdate */ secstatus macupdate(pk11context *ctx, unsigned char *msg, unsigned int msglen) { secstatus rv = pk11_digestop(ctx, msg, msglen); if (rv != secsuccess) { pr_fprintf(pr_stderr, "compute mac failed : digestop()\n"); } return rv; } /* * finalize macing */ secstatus macfinal(pk11context *ctx, unsigned char *mac, unsigned int *maclen, unsigned int maxlen) { secstatus rv = pk11_digestfinal(ctx, mac, ...
...maclen, maxlen); if (rv != secsuccess) { pr_fprintf(pr_stderr, "compute mac failed : pk11_digestfinal()\n"); } return secsuccess; } /* * compute mac */ secstatus computemac(pk11context *ctxmac, unsigned char *ptext, unsigned int ptextlen, unsigned char *mac, unsigned int *maclen, unsigned int maxlen) { secstatus rv = macinit(ctxmac); if (rv != secsuccess) return rv; rv = macupdate(ctxmac, ptext, ptextlen); if (rv != secsuccess) return rv; rv = macfinal(ctxmac, mac, maclen, maxlen); return rv; } /* * writetoheaderfile */ secstatus writetoheaderfile(const char *buf, unsigned int len, headertype type, prfiledesc *outfile) { secstatus rv; char header[40]; char trailer[40]; char *outstring = null; switch (type) { case symkey: strcpy(header, enckey_header); strcpy(trailer, enckey_trailer); break; ca...
...size; } rv = encrypt(ctxenc, encbuf, &encbuflen, sizeof(encbuf), ptext, ptextlen); if (rv != secsuccess) { pr_fprintf(pr_stderr, "encrypt failure\n"); goto cleanup; } /* save the last block of ciphertext as the next iv */ iv = encbuf; ivlen = encbuflen; /* write the cipher text to intermediate file */ nwritten = pr_write(encfile, encbuf, encbuflen); /*pr_assert(nwritten == encbuflen);*/ rv = macupdate(ctxmac, ptext, ptextlen); } rv = macfinal(ctxmac, mac, &maclen, digestsize); if (rv != secsuccess) { pr_fprintf(pr_stderr, "macfinal failure\n"); goto cleanup; } if (maclen == 0) { pr_fprintf(pr_stderr, "bad mac length\n"); rv = secfailure; goto cleanup; } writetoheaderfile(mac, maclen, mac, headerfile); if (rv != secsuccess) { pr_fprintf(pr_stderr, "write mac failure\n"); goto cleanup; } pad[0] ...
...k, iv, ivlen, ckm_aes_cbc); filelength = filesize(encryptedfilename); while ((ctextlen = pr_read(infile, ctext, sizeof(ctext))) > 0) { count += ctextlen; /* decrypt cipher text buffer using cbc and iv */ rv = decrypt(ctxenc, decbuf, &decbuflen, sizeof(decbuf), ctext, ctextlen); if (rv != secsuccess) { pr_fprintf(pr_stderr, "decrypt failure\n"); goto cleanup; } if (decbuflen == 0) break; rv = macupdate(ctxmac, decbuf, decbuflen); if (rv != secsuccess) { goto cleanup; } if (count == filelength) { decbuflen = decbuflen-paddinglength; } /* write the plain text to out file */ temp = pr_write(outfile, decbuf, decbuflen); if (temp != decbuflen) { pr_fprintf(pr_stderr, "write error\n"); rv = secfailure; break; } /* save last block of ciphertext */ memcpy(iv, decbuf, decbuflen); ivlen = decbuflen; bloc...
NSS tools : certutil
-n nickname specify the nickname of a certificate or key to list, create, add to a database, modify, or validate.
... certutil -d -d [sql:]directory -n "nickname" for example: $ certutil -d -d sql:/home/my/sharednssdb -n "my-ssl-cert" validating certificates a certificate contains an expiration date in itself, and expired certificates are easily rejected.
... however, certificates can also be revoked before they hit their expiration date.
... certutil -v -n certificate-name [-b time] [-e] [-u cert-usage] -d [sql:] directory for example, to validate an email certificate: $ certutil -v -n "john smith's email cert" -e -u s,r -d sql:/home/my/sha rednssdb modifying certificate trust settings the trust settings (which relate to the operations that a certificate is allowed to be used for) can be changed after a certificate is created or added to the database.
certutil
-n nickname specify the nickname of a certificate or key to list, create, add to a database, modify, or validate.
... certutil -d -d [sql:]directory -n "nickname" for example: $ certutil -d -d sql:/home/my/sharednssdb -n "my-ssl-cert" validating certificates a certificate contains an expiration date in itself, and expired certificates are easily rejected.
... however, certificates can also be revoked before they hit their expiration date.
... certutil -v -n certificate-name [-b time] [-e] [-u cert-usage] -d [sql:]directory for example, to validate an email certificate: $ certutil -v -n "john smith's email cert" -e -u s,r -d sql:/home/my/sharednssdb modifying certificate trust settings the trust settings (which relate to the operations that a certificate is allowed to be used for) can be changed after a certificate is created or added to the database.
NSS tools : signtool
-i scriptname specifies the name of an installer script for smartupdate.
... this script installs files from the jar archive in the local system after smartupdate has validated the digital signature.
...for information on using the -m option to verify fips-140-1 validated mode, see "netscape signing tool and fips-140-1".
...this option is useful if you want the expiration date of the signature checked against the current date and time rather than the time the files were signed.
Multithreading in Necko
warning: the content of this article may be out of date.
... it was last updated in 2001.
...file, finger, datetime) do not worry about threading issues.
... original document information author(s): darin fisher last updated date: december 10, 2001 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
SpiderMonkey Internals
standard library the methods for arrays, booleans, dates, functions, numbers, and strings are implemented using the js api.
...the line-to-pc direction "rounds" toward the next bytecode generated from a line greater than or equal to the input line, and may return the pc of a for-loop update part, if given the line number of the loop body's closing brace.
... jsarray.*, jsbool.*, jsdate.*, jsfun.*, jsmath.*, jsnum.*, jsstr.* these file pairs implement the standard classes and (where they exist) their underlying primitive types.
...to make matters worse, java (and therefore javascript) uses "local" time numbers (offsets from the epoch) in its date class.
A Web PKI x509 certificate primer
self-sign csr (using sha256) and append the extensions described in the file "openssl x509 -req -sha256 -days 3650 -in example.csr -signkey key.pem -set_serial $any_integer -extfile openssl.ss.cnf -out example.pem" you can now use example.pem as your certfile cas included in firefox when you visit a secure website, firefox will validate the website’s certificate by checking that the certificate that signed it is valid, and checking that the certificate that signed the parent certificate is valid and so forth up to a root certificate that is known to be valid.
... generate your ca root update *.example.com and *.example.net below to match your domains.
...ertsign, crlsign extendedkeyusage =serverauth authorityinfoaccess = ocsp;uri:http://ocsp.example.com:8888/ sign the intermediate csr with the root key and the intermediate extensions "openssl x509 -req -sha256 -days 2922 -in int.csr -cakey rootkey.pem -ca root.pem -set_serial $some_large_integer -out int.pem -extfile openssl.int.cnf" generate the end entity certificate update www.example.com below to match your domain.
...for the end date of the root cert created following the instructions in this page (year 2017).
AT APIs Support
but in the meantime it more up-to-date and contains more details than existed analogues for at-spi and msaa this documentation explains how makers of screen readers, voice dictation packages, onscreen keyboards, magnification software and other assitive technologies can support gecko-based software.
...firefox extensions) gecko version for firefox and all other gecko-based products: this documentation applies to up-to-date product builds based on gecko 1.9.2 -- currently not available on official releases.
...however it's preferable to grab the current build of firefox or any other gecko-based product to be up to dated: firefox recent builds thunderbird recent builds seamonkey recent builds determining if accessibility is enabled in a firefox accessibility is enabled on windows and linux platforms by default.
...please note that the web docs are sometimes out of date, and the latest at-spi is available on cvs.
imgIContainer
void frameupdated(in unsigned long framenum, in nsintrect anewrect); native code only!
... return value missing description exceptions thrown missing exception missing description native code only!frameupdated obsolete since gecko 2.0 (firefox 4 / thunderbird 3.3 / seamonkey 2.1)this feature is obsolete.
...void frameupdated( in unsigned long framenum, in nsintrect anewrect ); parameters framenum missing description anewrect missing description exceptions thrown missing exception missing description native code only!getcurrentframerect obsolete since gecko 2.0 (firefox 4 / thunderbird 3.3 / seamonkey 2.1)this feature is obsolete.
...exceptions thrown missing exception missing description violates the xpcom interface guidelines requestrefresh() indicates that this imgicontainer has been triggered to update its internal animation state.
mozIAsyncHistory
mozilla.org/browser/history;1 as a service: var asynchistory = components.classes["@mozilla.org/browser/history;1"] .getservice(components.interfaces.moziasynchistory); method overview void getplacesinfo(in jsval aplaceidentifiers, in mozivisitinfocallback acallback); void isurivisited(in nsiuri auri, in mozivisitedstatuscallback acallback); void updateplaces(in moziplaceinfo, [optional] in mozivisitinfocallback acallback); methods getplacesinfo() starts an asynchronous request to determine whether or not a given uri has been visited; you must implement a callback to receive the result of the request.
... updateplaces() adds a set of visits for one or more moziplaceinfo objects, and updates each moziplaceinfo's title or guid.
...void updateplaces( in moziplaceinfo aplaceinfo, in mozivisitinfocallback acallback optional ); parameters aplaceinfo the moziplaceinfo object[s] containing the information to store or update.
... not providing a visitdate and transitiontype for each mozivisitinfo.
mozISpellCheckingEngine
when this attribute's value is changed, a "spellcheck-dictionary-update" notification is sent.
... when this changes, the spell checker sends a "spellcheck-dictionary-update" notification.
...when this changes, the spell checker sends a "spellcheck-dictionary-update" notification.
...when this changes, the spell checker sends a "spellcheck-dictionary-update" notification.
nsICRLInfo
lastupdate prtime the time this crl was created at.
... lastupdatelocale astring lastupdate formatted as a human readable string formatted according to the environment locale.
... nextupdate prtime the time the suggested next update for this crl.
... nextupdatelocale astring nextupdate formatted as a human readable string formatted according to the environment locale.
nsIDeviceMotion
methods addlistener() when called, the accelerometer support implementation must begin to notify the specified nsidevicemotionlistener by calling its nsidevicemotionlistener.onaccelerationchange() method as appropriate to share updated acceleration data.
... void addlistener( in nsidevicemotionlistener alistener ); parameters alistener the nsidevicemotionlistener object whose nsidevicemotionlistener.onaccelerationchange() method should be called with updated acceleration data.
... removelistener() tells the accelerometer to stop sending updates to the specified nsidevicemotionlistener.
... void removelistener( in nsidevicemotionlistener alistener ); parameters alistener the nsidevicemotionlistener object to which no further updates should be sent.
nsIEditorSpellCheck
g); void removewordfromdictionary(in wstring word); void replaceword(in wstring misspelledword, in wstring replaceword, in boolean alloccurrences); void savedefaultdictionary(); obsolete since gecko 9.0 void setcurrentdictionary(in astring dictionary); void setfilter(in nsitextservicesfilter filter); void uninitspellchecker(); void updatecurrentdictionary(); methods addwordtodictionary() adds the specified word to the current personal dictionary.
...updatecurrentdictionary() updates the dictionary in use to be sure it corresponds to what the editor needs.
... void updatecurrentdictionary(); parameters none.
... remarks prior to gecko 9.0 (firefox 9.0 / thunderbird 9.0 / seamonkey 2.6), this method took one parameter, a reference to the nsieditor for which to update the spell checker.
nsIFile
much of the documentation has not been updated to reflect this change.
... note: if this method succeeds, this instance will be updated to point to the new file.
...[native character encoding variant] note: if this method succeeds, this instance will be updated to point to the new file.
... this method is identical to moveto except that if this file or directory is moved to a a different volume, it fails and if this method succeeds, this instance will not updated to point to the new file.
nsIGeolocationProvider
after startup() is called, any geo location change should call callback.update().
... the nsigeolocationprovider interface provides information about the current users location to interested parties via nsigeolocationupdate.
...method overview boolean isready(); obsolete since gecko 1.9.2 void shutdown(); void startup(); void watch(in nsigeolocationupdate callback); methods isready() obsolete since gecko 1.9.2 (firefox 3.6 / thunderbird 3.1 / fennec 1.0) reports whether or not the device is ready and has a position.
...void watch( in nsigeolocationupdate callback ); parameters callback an nsigeolocationupdate to be notified when position changes.
nsIMicrosummary
.0 inherits from: nsisupports last changed in gecko 1.9 (firefox 3) warning: microsummary support was removed in gecko 6.0 (firefox 6.0 / thunderbird 6.0 / seamonkey 2.3) method overview void addobserver(in nsimicrosummaryobserver observer); boolean equals(in nsimicrosummary aother); void removeobserver(in nsimicrosummaryobserver observer); void update(); attributes attribute type description content astring the content of the microsummary.
... updateinterval long the minimum interval after which this microsummary would like to be refreshed or null if it doesn't care.
... update() update the microsummary, first loading its generator and page content as necessary.
...void update(); see also microsummary topics creating a microsummary ...
nsIWinAppHelper
method overview void fixreg(); obsolete since gecko 1.9 void postupdate(in nsilocalfile logfile); obsolete since gecko 1.9.2 attributes attribute type description usercanelevate boolean read only.
... postupdate() obsolete since gecko 1.9.2 (firefox 3.6 / thunderbird 3.1 / fennec 1.0) invokes helper.exe with the /postupdate parameter.
... this updates the uninstallation log so that the application can be uninstalled correctly after an update.
... void postupdate( in nsilocalfile logfile ); parameters logfile the file to use for the uninstallation log.
nsIXULAppInfo
attributes attribute type description appbuildid acstring the application's build id/date, for example "2004051604".
...has to be defined for advanced application features such as the extension manager and update service.
... platformbuildid acstring the build id/date of gecko and the xulrunner platform.
...can be an empty string, but a valid value is required for xul applications using the extension manager or update service.
XPCOM Interface Reference by grouping
ginmanager nsiloginmanagerstorage nsiloginmetainfo history nsiglobalhistory nsiglobalhistory2 nsiglobalhistory3 ssl nsibadcertlistener2 system action nsicancelable application application nsiapplicationupdateservice nsiappshell nsiappshellservice nsiappstartup xul nsixulappinfo nsixulruntime nsixultemplatebuilder nsixultemplatequeryprocessor nsixultemplateresult bookmark livemark nsilivemarkserv...
...isocketproviderservice nsisockettransport nsisockettransportservice nsisupports nsiuuidgenerator debug nsistackframe device display nsiscreen nsiscreenmanager geolocation nsigeolocationprovider nsigeolocationupdate orientation nsiacceleration nsiaccelerationlistener nsiaccelerometer misc nsisound nsiwifimonitor document nsiwebnavigation environment nsienvironment event nsieventlisten...
... windows nsitaskbarpreview nsitaskbarpreviewbutton nsitaskbarpreviewcontroller nsitaskbarprogress nsitaskbartabpreview nsitaskbarwindowpreview nsiwintaskbar nsialertsservice nsiwebprogress nsiwebprogresslistener nsiwebprogresslistener2 update nsiupdate nsiupdatechecker nsiupdatechecklistener nsiupdateitem nsiupdatemanager nsiupdatepatch nsiupdateprompt nsiupdatetimermanager nsiprogramminglanguage thunderbird credentials nsimsgaccountmanagerextension element nsieditormailsupport ...
... message nsidbchangeannouncer nsidbchangelistener nsimessenger nsimsgcompfields nsimsgcustomcolumnhandler nsimsgdatabase nsimsgdbhdr nsimsgdbview nsimsgdbviewcommandupdater nsimsgfolder nsimsgidentity nsimsgmessageservice nsimsgsendlater nsimsgthread nsimsgwindow nsimsgwindowcommands user history nsibrowserhistory nsibrowsersearchservice nsimicrosummary nsimicrosummarygenerator nsimicrosummaryobserver nsimicrosummaryservice nsimicrosummaryset ...
Mail and RDF
warning: the content of this article may be out of date.
... it was imported from mozilla.org and last updated in 1999.
... reflecting data to rdf in order to have a dynamic ui that updates when the underlying content changes, a datasource must implement two key methods of reflecting data into rdf.
... content observers update ui.
Mail composition back end
warning: the content of this article may be out of date.
... it was imported from mozilla.org and last updated in 2000.
...od onprogress(const char *amsgid, - the message id for the message being sent pruint32 aprogress, - the progress so far pruint32 aprogressmax) = 0; - the maximum progress (aprogress should be used as a numerator and aprogressmax as a denominator for a message sent percentage) onstatus the onstatus gives the listener status updates for the current operation.
... ns_imethod onprogress( pruint32 acurrentmessage, - the current message being sent pruint32 atotalmessage) = 0; - the total messages to be sent createandsendmessage the onstatus gives the listener status updates for the current operation.
Mail event system
warning: the content of this article may be out of date.
... it was imported from mozilla.org and last updated in 2002.
...the folder pane needs to know that this changed so that it can update the message count so the user can see it.
...in its implementation of onintpropertychanged, it uses this information to update the message count in the dialog.
Demo Addon
to list some messages of the folder we use: for each (let msghdr in fixiterator(inbox.msgdatabase.enumeratemessages(), ci.nsimsgdbhdr)) { if (++i >= 10 && lastmsghdr != null) break; messages.push({ author: msghdr.mime2decodedauthor, subject: msghdr.mime2decodedsubject, date: new date(msghdr.date/1000), }); //...
...we iterate over the first ten of them and extract author, subject and date for each one.
...ylistener_onitemsremoved(aitems, acollection) { }, /* called when our database query completes */ onquerycompleted: function mylistener_onquerycompleted(acollection) { let items = acollection.items; let data = { messages: [], }; for (let i in items) { data.messages.push({ subject: items[i].subject, date: items[i].date, author: items[i].from.value, }); // ...
...for every gloda message subject, date and author is extracted.
Edit fonts - Firefox Developer Tools
note: the updated font tools as shown in this article are available in firefox 63 onwards; if you are using an older version of firefox the tools will not look or behave quite the same, but they will be similar (most notably the font editor will not be available).
... warning: in order to use variable fonts, you need to make sure that your operating system is up to date.
...if your operating system is not up to date, you will not be able to use variable fonts in web pages or the firefox developer tools.
... you can adjust the axes individually or, if the font designer has included defined instances, you can select one from the "instance" drop-down list and view the updates live on your page.
Frame rate - Firefox Developer Tools
a frame rate of 60fps is the target for smooth performance, giving you a time budget of 16.7ms for all the updates needed in response to some event.
... in web performance, a frame encapsulates the work the browser needs to do in order to update and repaint the screen.
... similarly, if scrolling through a page involves a lot of complex page updates and the browser can't keep up an acceptable frame rate, scrolling the page will appear sluggish or will occasionally freeze.
... a frame rate of 60fps is reckoned to be the target for smooth performance, giving you a time budget of 16.7ms for all the updates that need to be made synchronously in response to some event.
Intensive JavaScript - Firefox Developer Tools
here's the code, together with its immediate caller: const iterations = 50; const multiplier = 1000000000; function calculateprimes(iterations, multiplier) { var primes = []; for (var i = 0; i < iterations; i++) { var candidate = i * (multiplier * math.random()); var isprime = true; for (var c = 2; c <= math.sqrt(candidate); ++c) { if (candidate % c === 0) { // not prime isprime = false; break; } } if (isprime) { primes.push(candidate); } } return primes; } function dopointlesscomputationswithblocking() { var primes = calculateprimes(iterations,...
... it's pretty simple to split up calculateprimes(): we will just calculate primality for each number in a separate function: function dopointlesscomputationswithrequestanimationframe() { function testcandidate(index) { // finishing condition if (index == iterations) { console.log(primes); pointlesscomputationsbutton.disabled = false; return; } // test this number var candidate = index * (multiplier * math.random()); var isprime = true; for (var c = 2; c <= math.sqrt(candidate); ++c) { if (candidate % c === 0) { // not prime isprime...
... = false; break; } } if (isprime) { primes.push(candidate); } // schedule the next var testfunction = testcandidate.bind(this, index + 1); window.requestanimationframe(testfunction); } var primes = []; var testfunction = testcandidate.bind(this, 0); window.requestanimationframe(testfunction); } let's test this version out: select the radio button labeled "use requestanimationframe" and capture another profile.
...self.addeventlistener("message", go); function go(message) { var iterations = message.data.iterations; var multiplier = message.data.multiplier; primes = calculateprimes(iterations, multiplier); self.postmessage({ "command":"done", "primes": primes }); } function calculateprimes(iterations, multiplier) { var primes = []; for (var i = 0; i < iterations; i++) { var candidate = i * (multiplier * math.random()); var isprime = true; for (var c = 2; c <= math.sqrt(candidate); ++c) { if (candidate % c === 0) { // not prime isprime = false; break; } } if (isprime) { primes.push(candidate); } } return primes; } in the worker, we have to listen for a message telling us to start, and send a "done" messa...
AddressErrors.dependentLocality - Web APIs
an object based on addresserrors includes a dependentlocality property when the address's dependentlocality property couldn't be validated.
... syntax var localityerror = addresserrors.dependentlocality; value if the value specified in the paymentaddress object's dependentlocality property could not be validated, this property contains a domstring offering a human-readable explanation of the validation error and offers suggestions for correcting it.
... if the dependentlocality value was validated successfully, this property is not included in the addresserrors object.
... candidate recommendation initial definition.
AddressErrors.languageCode - Web APIs
an object based on addresserrors includes a languagecode property when the address's languagecode property couldn't be validated.
... syntax var languageerror = addresserrors.languagecode; value if the value specified in the paymentaddress object's languagecode property could not be validated, this property contains a domstring offering a human-readable explanation of the validation error and offers suggestions for correcting it.
... if the languagecode value was validated successfully, this property is not included in the addresserrors object.
... candidate recommendation initial definition.
AddressErrors.organization - Web APIs
an object based on addresserrors includes an organization property when the address's organization property couldn't be validated.
... syntax var organizationerror = addresserrors.organization; value if the value specified in the paymentaddress object's organization property could not be validated, this property contains a domstring offering a human-readable explanation of the validation error and offers suggestions for correcting it.
... for example, if validation simply ensures that only permitted characters are included in the organization's name, this might return a string such as "the organization name may only contain the letters a-z, digits, spaces, and commas." if the organization value was validated successfully, this property is not included in the addresserrors object.
... candidate recommendation initial definition.
AddressErrors.phone - Web APIs
an object based on addresserrors includes a phone property when the address's phone property couldn't be validated.
... syntax var phoneerror = addresserrors.phone; value if the value specified in the paymentaddress object's phone property could not be validated, this property contains a domstring offering a human-readable explanation of the validation error and offers suggestions for correcting it.
... if the phone value was validated successfully, this property is not included in the addresserrors object.
... candidate recommendation initial definition.
AddressErrors.postalCode - Web APIs
an object based on addresserrors includes a postalcode property when the address's postalcode property couldn't be validated.
... syntax var postcodeerror = addresserrors.postcode; value if the value specified in the paymentaddress object's postalcode property could not be validated, this property contains a domstring offering a human-readable explanation of the validation error and offers suggestions for correcting it.
... if the postalcode value was validated successfully, this property is not included in the addresserrors object.
... candidate recommendation initial definition.
AddressErrors.recipient - Web APIs
an object based on addresserrors includes a recipient property when the address's recipient property couldn't be validated.
... syntax var recipienterror = addresserrors.recipient; value if the value specified in the paymentaddress object's recipient property could not be validated, this property contains a domstring offering a human-readable explanation of the validation error and offers suggestions for correcting it.
... if the recipient value was validated successfully, this property is not included in the addresserrors object.
... candidate recommendation initial definition.
AddressErrors.region - Web APIs
an object based on addresserrors includes a region property when the address's region property couldn't be validated.
... syntax var regionerror = addresserrors.region; value if the value specified in the paymentaddress object's region property could not be validated, this property contains a domstring offering a human-readable explanation of the validation error and offers suggestions for correcting it.
... if the region value was validated successfully, this property is not included in the addresserrors object.
... candidate recommendation initial definition.
AddressErrors.regionCode - Web APIs
an object based on addresserrors includes a regioncode property when the address's regioncode property couldn't be validated.
... syntax var regioncodeerror = addresserrors.regioncode; value if the value specified in the paymentaddress object's regioncode property could not be validated, this property contains a domstring offering a human-readable explanation of the validation error and offers suggestions for correcting it.
... if the regioncode value was validated successfully, this property is not included in the addresserrors object.
... candidate recommendation initial definition.
AddressErrors.sortingCode - Web APIs
an object based on addresserrors includes a sortingcode property when the address's sortingcode property couldn't be validated.
... syntax var sortingcodeerror = addresserrors.sortingcode; value if the value specified in the paymentaddress object's sortingcode property could not be validated, this property contains a domstring offering a human-readable explanation of the validation error and offers suggestions for correcting it.
... if the sortingcode value was validated successfully, this property is not included in the addresserrors object.
... candidate recommendation initial definition.
BatteryManager - Web APIs
event handlers batterymanager.onchargingchange a handler for the chargingchange event; this event is sent when the battery charging state is updated.
... batterymanager.onchargingtimechange a handler for the chargingtimechange event; this event is sent when the battery charging time is updated batterymanager.ondischargingtimechange a handler for the dischargingtimechange event; this event is sent when the battery discharging time is updated.
... batterymanager.onlevelchange a handler for the levelchange event; this event is sent when the battery level is updated.
... void seteventhandler(domstring type, eventhandler handler) eventhandler geteventhandler(domstring type) specifications specification status comment battery status api candidate recommendation initial definition ...
HTMLKeygenElement - Web APIs
this is the empty string if the control is not a candidate for constraint validation (willvalidate is false), or it satisfies its constraints.
... willvalidate is a boolean that is always false because keygen objects are never candidates for constraint validation.
... methods name & arguments return description checkvalidity() boolean always returns true because keygen objects are never candidates for constraint validation.
...if this message is not the empty string, then the element is suffering from a custom validity error, and does not validate.
HTMLSelectElement - Web APIs
this attribute is the empty string if the control is not a candidate for constraint validation (willvalidate is false), or it satisfies its constraints.
... htmlselectelement.willvalidateread only a boolean that indicates whether the button is a candidate for constraint validation.
...this will tell you when the value changes, and you can then update anything you need to.
... it adds the autofocus, form, required, labels, selectedoptions, willvalidate, validity and validationmessage properties.
Ajax navigation example - Web APIs
function ajaxerror () { alert("unknown error."); } function ajaxload () { var vmsg, nstatus = this.status; switch (nstatus) { case 200: vmsg = json.parse(this.responsetext); document.title = opageinfo.title = vmsg.page; document.getelementbyid(stargetid).innerhtml = vmsg.content; if (bupdateurl) { history.pushstate(opageinfo, opageinfo.title, opageinfo.url); bupdateurl = false; } break; default: vmsg = nstatus + ": " + (ohttpstatus[nstatus] || "unknown"); switch (math.floor(nstatus / 100)) { /* case 1: // i...
... bisloading = true; oreq.onload = ajaxload; oreq.onerror = ajaxerror; if (spage) { opageinfo.url = filterurl(spage, null); } oreq.open("get", filterurl(opageinfo.url, "json"), true); oreq.send(); oloadingbox.parentnode || document.body.appendchild(oloadingbox); } function requestpage (surl) { if (history.pushstate) { bupdateurl = true; getpage(surl); } else { /* ajax navigation is not supported */ location.assign(surl); } } function processlink () { if (this.classname === sajaxclass) { requestpage(this.href); return false; } return true; } function init () { opageinfo.title = document.title; ...
...ailable", 504: "gateway timeout", 505: "http version not supported", 506: "variant also negotiates (experimental)", 507: "insufficient storage", 508: "loop detected", 509: "unassigned", 510: "not extended", 511: "network authentication required" }; var oreq, bisloading = false, bupdateurl = false; oloadingbox.id = "ajax-loader"; ocover.onclick = abortreq; oloadingimg.src = "data:image/gif;base64,r0lgodlheaaqapiaap///waaamlcwkjcqgaaagjiyokcgpkskih/c05fvfndqvbfmi4waweaaaah/hpdcmvhdgvkihdpdgggywphegxvywquaw5mbwah+qqjcgaaacwaaaaaeaaqaaadmwi63p4wyklre2mioggznadomgyjrbexwroumcg2lmdewnhqlvsyod2mbzkydadka+diaaah+qqjcgaaacwaaaaaeaaqaaadnai63p5ojcegg4qmu7dmikrxqlfuydezigbmrv...
...i6imkqorfjdoe82p4wgccc4ceuqradylesojembgsuc2g7sdx3lqgbmlajibufbslkaaah+qqjcgaaacwaaaaaeaaqaaadmgi63p7wcrhznfvdmghu2nfwlwci3wgc3tswhufgxtaukgcbtgenbmjaejsxgmlwzpeaach5bakkaaaalaaaaaaqabaaaamyclrc/jdksatlqtsckdcecajdii7hcq4emtcpyrcuubjcyrghvtqlaib1yhicnlsrkaaaowaaaaaaaaaaaa=="; ocover.appendchild(oloadingimg); oloadingbox.appendchild(ocover); onpopstate = function (oevent) { bupdateurl = false; opageinfo.title = oevent.state.title; opageinfo.url = oevent.state.url; getpage(); }; window.addeventlistener ?
MouseEvent.pageX - Web APIs
WebAPIMouseEventpageX
see browser compatibility to learn which browsers have been updated to use the revised data type.
... javascript var box = document.queryselector(".box"); var pagex = document.getelementbyid("x"); var pagey = document.getelementbyid("y"); function updatedisplay(event) { pagex.innertext = event.pagex; pagey.innertext = event.pagey; } box.addeventlistener("mousemove", updatedisplay, false); box.addeventlistener("mouseenter", updatedisplay, false); box.addeventlistener("mouseleave", updatedisplay, false); the javascript code uses addeventlistener() to register the function updatedisplay() as the event handler for the mousemove, mouseenter, and...
... updatedisplay() simply replaces the contents of the <span> elements meant to contain the x and y coordinates with the values of pagex and pagey.
...those will be updated each time an event occurs to contain the latest mouse coordinates relative to the page.
PaymentDetailsBase - Web APIs
the paymentdetailsbase dictionary is a mixin used by the paymentdetailsinit and paymentdetailsupdate dictionaries.
... paymentdetailsupdate provides updated payment details while the payment user interface is being handled.
... this can be delivered to the payment interface using either paymentdetailsupdateevent.updatewith() or by returning it from the optional detailsupdate promise provided to the paymentrequest.show() call that begins the user interaction.
... candidate recommendation initial definition.
PaymentRequest.onmerchantvalidation - Web APIs
the paymentrequest event handler onmerchantvalidation is invoked when the merchantvalidation is fired, indicating that the payment handler (e.g., apple pay) requires the merchant to validate themselves.
... this is usually the first event to be fired, and the user won't be able to proceed with a payment until the merchant validate themselves.
... syntax paymentrequest.onmerchantvalidation = eventhandlerfunction; value an event handler function which is to be called whenever the merchantvalidation event is fired at the paymentrequest, indicating that the payment handler requires the merchant to validate themselves as allowed to use this payment handler.
... candidate recommendation initial definition.
PaymentRequest.shippingAddress - Web APIs
when the paymentrequest.onshippingaddresschange is called, updatedetails() is called to update the details of the paymentrequest, using shippingaddress to set the correct shipping cost.
...var payment = new paymentrequest(supportedinstruments, details, options); payment.addeventlistener('shippingaddresschange', function(evt) { evt.updatewith(new promise(function(resolve) { updatedetails(details, request.shippingaddress, resolve); })); }); payment.show().then(function(paymentresponse) { // processing of paymentresponse exerpted for brevity.
... }).catch(function(err) { console.error("uh oh, something bad happened", err.message); }); function updatedetails(details, shippingaddress, resolve) { if (shippingaddress.country === 'us') { var shippingoption = { id: '', label: '', amount: {currency: 'usd', value: '0.00'}, selected: true }; if (shippingaddress.region === 'mo') { shippingoption.id = 'mo'; shippingoption.label = 'free shipping in missouri'; details.total.amount.value = '55.00'; } else { shippingoption.id = 'us'; shippingoption.label = 'standard shipping in us'; shippingoption.amount.value = '5.00'; details.total.amount.value = '60.00'; } details.displayitems.splice(2, 1, shippingoption); details.shippingoptions = [shippingoption...
... candidate recommendation initial definition.
PaymentRequest.shippingOption - Web APIs
in each calls to updatedetails() are made, one using a promise, and the other with a plain js object.
... this demotrates synchrounous and asynchronous updates to a payment sheet.
... const request = new paymentrequest(methoddata, details, options); // async update to details request.onshippingaddresschange = ev => { ev.updatewith(checkshipping(request)); }; // sync update to the total request.onshippingoptionchange = ev => { const shippingoption = shippingoptions.find( option => option.id === request.id ); const newtotal = { currency: "usd", label: "total due", value: calculatenewtotal(shippingoption), }; ev.updatewith({ ...details, total: newtotal }); }; async function checkshipping(request) { try { const json = request.shippingaddress.tojson(); await ensurecanshipto(json); const { shippingoptions, total } = await calculateshipping(json); return { ...details, shippingoptions, total }; } catch (err) { return { ...det...
... candidate recommendation initial definition.
PaymentResponse.onpayerdetailchange - Web APIs
examples in the example below, onpayerdetailchange is used to set up a listener for the payerdetailchange event in order to validate the information entered by the user, requesting that any mistakes be corrected // options for paymentrequest(), indicating that shipping address, // payer email address, name, and phone number all be collected.
... response.onpayerdetailchange = async ev => { const promisestovalidate = []; const { payername, payeremail, payerphone } = response; // validate each value which changed by calling a function // that validates each type of data, returning a promise which // resolves if the data is valid.
... if (oldpayername !== payername) { promisestovalidate.push(validatename(payername)); oldpayername = payername; } if (oldpayeremail !== payeremail) { promisestovalidate.push(validateemail(payeremail)); oldpayeremail = payeremail; } if (oldpayerphone !== payerphone) { promisestovalidate.push(validatephone(payerphone)); oldpayerphone = payerphone; } // as each validation promise resolves, add the results of the // validation to the errors list const errors = await promise.all(promisestovalidate).then(results => results.reduce((errors, result), object.assign(errors, result)) ); // if we found any errors, wait for them to be corrected if (object.getownpropertynames(errors).length) { await response.retry(errors); } else { // we have ...
... candidate recommendation initial definition.
PaymentResponse.shippingAddress - Web APIs
when the paymentrequest.onshippingaddresschange is called, updatedetails() is called to update the details of the paymentrequest, using shippingaddress to set the correct shipping cost.
... var payment = new paymentrequest(supportedinstruments, details, options); request.addeventlistener('shippingaddresschange', function(evt) { evt.updatewith(new promise(function(resolve) { updatedetails(details, request.shippingaddress, resolve); })); }); payment.show().then(function(paymentresponse) { // processing of paymentresponse exerpted for the same of brevity.
... }).catch(function(err) { console.error("uh oh, something bad happened", err.message); }); function updatedetails(details, shippingaddress, resolve) { if (shippingaddress.country === 'us') { var shippingoption = { id: '', label: '', amount: {currency: 'usd', value: '0.00'}, selected: true }; if (shippingaddress.region === 'mo') { shippingoption.id = 'mo'; shippingoption.label = 'free shipping in missouri'; details.total.amount.value = '55.00'; } else { shippingoption.id = 'us'; shippingoption.label = 'standard shipping in us'; shippingoption.amount.value = '5.00'; details.total.amount.value = '60.00'; } details.displayitems.splice(2, 1, shippingoption); details.shippingoptions = [shippingoption];...
... } else { delete details.shippingoptions; } resolve(details); } specifications specification status comment payment request api candidate recommendation initial definition.
PaymentResponse.shippingOption - Web APIs
it calls updatedetails() to toggle the shipping method between "standard" and "express".
...var payment = new paymentrequest(supportedinstruments, details, options); request.addeventlistener('shippingoptionchange', function(evt) { evt.updatewith(new promise(function(resolve, reject) { updatedetails(details, request.shippingoption, resolve, reject); })); }); payment.show().then(function(paymentresponse) { // processing of paymentresponse exerpted for the same of brevity.
... }).catch(function(err) { console.error("uh oh, something bad happened", err.message); }); function updatedetails(details, shippingoption, resolve, reject) { var selectedshippingoption; var othershippingoption; if (shippingoption === 'standard') { selectedshippingoption = details.shippingoptions[0]; othershippingoption = details.shippingoptions[1]; details.total.amount.value = '55.00'; } else if (shippingoption === 'express') { selectedshippingoption = details.shippingoptions[1]; othershippingoption = details.shippingoptions[0]; details.total.amount.value = '67.00'; } else { reject('unknown shipping option \'' + shippingoption + '\''); return; } selectedshippingoption.selected = true; othershippingoption.selected = false; details.displayitem...
...s.splice(2, 1, selectedshippingoption); resolve(details); } specifications specification status comment payment request api candidate recommendation initial definition.
Payment processing concepts - Web APIs
validated merchants are allowed to interface with a payment handler.
...if the merchant doesn't successfully validate, it's not allowed to use the payment handler.
... specifications specification status comment payment request api candidate recommendation initial definition.
... payment method identifiers candidate recommendation defines payment method identifiers and how they are validated, and, where applicable, minted and formally registered with the w3c.
RTCIceComponent - Web APIs
these strings are mapped to corresponding numeric values as they appear in the candidate a-line in sdp.
...an rtcicecomponent of this value corresponds to the component id field in the candidate a-line with the value 1.
... usage notes the rtcicecomponent type is used by the component property of rtcicecandidate and rtcicetransport objects.
... candidate recommendation initial definition.
RTCPeerConnection.peerIdentity - Web APIs
if an error occcurs while attempting to validate an incoming identity assertion (that is, the information describing a peer's identity), the promise is rejected.
... note: the promise returned by setremotedescription() cannot resolve until any target peer identity that's been set is validated.
... if the identity hasn't been validated yet, the promise returned by setremotedescription() will be rejected.
...*/ async function getidentityassertion(pc) { try { const identity = await pc.peeridentity; return identity; } catch(err) { console.log("error identifying remote peer: ", err); return null; } } specifications specification status comment identity for webrtc candidate recommendation initial specification.
RTCPeerConnectionIceErrorEvent.address - Web APIs
if the local ip address isn't exposed as part of a local candidate, the value of address is null.
... examples this example creates a handler for icecandidateerror events which creates human readable messages describing the local network interface for the connection as well as the ice server that was being used to try to open the connection, then calls a function to display those as well as the event's errortext property's contents.
... pc.addeventlistener("icecandidateerror", (event) => { let networkinfo = `[local interface: ${event.address}:${event.port}`; let iceserverinfo = `[ice server: ${event.url}`; showmessage(errortext, iceserverinfo, networkinfo); }); specifications specification status comment webrtc 1.0: real-time communication between browsersthe definition of 'rtcpeerconnectioniceerrorevent.address' in that specification.
... candidate recommendation initial definition.
RTCPeerConnectionIceErrorEvent - Web APIs
the rtcpeerconnectioniceerrorevent interface—based upon the event interface—provides details pertaining to an ice error announced by sending an icecandidateerror event to the rtcpeerconnection object.
... properties the rtcpeerconnectioniceerrorevent interface includes the properties found on the event interface, as well as the following properties: address read only a domstring providing the local ip address used to communicate with the stun or turn server being used to negotiate the connection, or null if the local ip address has not yet been exposed as part of a local ice candidate.
...if no host candidate can reach the server, this property is set to the number 701, which is outside the range of valid stun error codes.
... candidate recommendation initial definition.
Sensor APIs - Web APIs
specifications specification status comment generic sensor api candidate recommendation initial definition.
... accelerometer candidate recommendation defines accelerometer and linearaccerationsensor.
... ambient light sensor candidate recommendation gyroscope candidate recommendation initial definition.
... magnetometer candidate recommendation orientation sensor candidate recommendation defines absoluteorientationsensor and relativeorientationsensor.
Using server-sent events - Web APIs
the php code for the example we're using here follows: date_default_timezone_set("america/new_york"); header("cache-control: no-cache"); header("content-type: text/event-stream"); $counter = rand(1, 10); while (true) { // every second, send a "ping" event.
... echo "event: ping\n"; $curdate = date(date_iso8601); echo 'data: {"time": "' .
... $curdate .
...$curdate .
Multi-touch interaction - Web APIs
ev.preventdefault(); // cache the touch points for later processing of 2-touch pinch/zoom if (ev.targettouches.length == 2) { for (var i=0; i < ev.targettouches.length; i++) { tpcache.push(ev.targettouches[i]); } } if (logevents) log("touchstart", ev, true); update_background(ev); } touch move handler the touchmove handler calls preventdefault() for the same reason mentioned above, and invokes the pinch/zoom handler.
... // ev.preventdefault(); if (logevents) log("touchmove", ev, false); // to avoid too much color flashing many touchmove events are started, // don't update the background if two touch points are active if (!(ev.touches.length == 2 && ev.targettouches.length == 2)) update_background(ev); // set the target element's border to dashed to give a clear visual // indication the element received a move event.
... update background color the background color of the touch areas will change as follows: no touch is white; one touch is yellow; two simultaneous touches is pink, and three or more simultaneous touches is lightblue.
... function update_background(ev) { // change background color based on the number simultaneous touches // in the event's targettouches list: // yellow - one tap (or hold) // pink - two taps // lightblue - more than two taps switch (ev.targettouches.length) { case 1: // single tap` ev.target.style.background = "yellow"; break; case 2: // two simultaneous touches ev.target.style.background = "pink"; break; default: // more than two simultaneous touches ev.target.style.background = "lightblue"; } } event logging the functions are used to log event activity to the application window, to support debugging and learning about ...
WebGLRenderingContext - Web APIs
webglrenderingcontext.bufferdata() updates buffer data.
... webglrenderingcontext.buffersubdata() updates buffer data starting at a passed offset.
... webglrenderingcontext.texsubimage2d() updates a sub-rectangle of the current webgltexture.
... webglrenderingcontext.validateprogram() validates a webglprogram.
Starting up and shutting down a WebXR session - Web APIs
the polyfill is maintained alongside the specification, and is kept up to date with the specification.
... additionally, it is updated to maintain compatibility with browsers as their support for webxr and other technologies related to it and to the implementation of the polyfill change over time.
... async function runsession(session) { let worlddata; session.addeventlistener("end", onsessionend); let canvas = document.queryselector("canvas"); gl = canvas.getcontext("webgl", { xrcompatible: true }); // set up webgl data and such worlddata = loadglprograms(session, "worlddata.xml"); if (!worlddata) { return null; } // finish configuring webgl worlddata.session.updaterenderstate({ baselayer: new xrwebgllayer(worlddata.session, gl) }); // start rendering the scene referencespace = await worlddata.session.requestreferencespace("unbounded"); worlddata.referencespace = referencespace.getoffsetreferencespace( new xrrigidtransform(worlddata.playerspawnposition, worlddata.playerspawnorientation)); worlddata.animationframerequestid = worlddata.
...this is done using the xrsession method updaterenderstate() to set the render state's baselayer to a newly-created xrwebgllayer encapsulating the webgl context.
Window.devicePixelRatio - Web APIs
.font = '18px arial'; ctx.textalign = 'center'; ctx.textbaseline = 'middle'; var x = size / 2; var y = size / 2; var textstring = "i love mdn"; ctx.filltext(textstring, x, y); monitoring screen resolution or zoom level changes in this example, we'll set up a media query and watch it to see when the device resolution changes, so that we can check the value of devicepixelratio to handle any updates we need to.
... let pixelratiobox = document.queryselector(".pixel-ratio"); let mqstring = `(resolution: ${window.devicepixelratio}dppx)`; const updatepixelratio = () => { let pr = window.devicepixelratio; let prstring = (pr * 100).tofixed(0); pixelratiobox.innertext = `${prstring}% (${pr.tofixed(2)})`; } updatepixelratio(); matchmedia(mqstring).addlistener(updatepixelratio); the string mqstring is set up to be the media query itself.
... the updatepixelratio() function fetches the current value of devicepixelratio, then sets the innertext of the element pixelratiobox to a string which displays the ratio both as a percentage and as a raw decimal value with up to two decimal places.
... then the updatepixelratio() function is called once to display the starting value, after which the media query is created using matchmedia() and addeventlistener() is called to set up updatepixelratio() as a handler for the change event.
Web APIs
WebAPI
erventionreportbody k keyboard keyboardevent keyboardlayoutmap keyframeeffect keyframeeffectoptions l largestcontentfulpaint layoutshift layoutshiftattribution linearaccelerationsensor linkstyle localfilesystem localfilesystemsync localmediastream location lock lockmanager lockedfile m midiaccess midiconnectionevent midiinput midiinputmap midimessageevent midioutputmap mscandidatewindowhide mscandidatewindowshow mscandidatewindowupdate msgestureevent msgraphicstrust msmanipulationevent msrangecollection mssitemodeevent magnetometer mathmlelement mediacapabilities mediacapabilitiesinfo mediaconfiguration mediadecodingconfiguration mediadeviceinfo mediadevices mediaelementaudiosourcenode mediaencodingconfiguration mediaerror mediaimage mediakeymessageevent medi...
...ture_float_linear oes_texture_half_float oes_texture_half_float_linear oes_vertex_array_object ovr_multiview2 offlineaudiocompletionevent offlineaudiocontext offscreencanvas orientationsensor oscillatornode overconstrainederror p pagetransitionevent paintworklet pannernode parentnode passwordcredential path2d payererrors paymentaddress paymentcurrencyamount paymentdetailsbase paymentdetailsupdate paymentitem paymentmethodchangeevent paymentrequest paymentrequestevent paymentrequestupdateevent paymentresponse paymentvalidationerrors pbkdf2params performance performanceentry performanceeventtiming performanceframetiming performancelongtasktiming performancemark performancemeasure performancenavigation performancenavigationtiming performanceobserver performanceobserverentrylist perfo...
...tion progressevent promiserejectionevent publickeycredential publickeycredentialcreationoptions publickeycredentialrequestoptions pushevent pushmanager pushmessagedata pushregistrationmanager pushsubscription r rtcansweroptions rtccertificate rtcconfiguration rtcdtmfsender rtcdtmftonechangeevent rtcdatachannel rtcdatachannelevent rtcdtlstransport rtcerror rtcerrorevent rtcicecandidate rtcicecandidateinit rtcicecandidatepair rtcicecandidatepairstats rtcicecandidatestats rtcicecandidatetype rtcicecomponent rtcicecredentialtype rtcicegathererstate rtciceparameters rtciceprotocol rtcicerole rtciceserver rtcicetcpcandidatetype rtcicetransport rtcicetransportstate rtcidentityassertion rtcidentityerrorevent rtcidentityevent rtcinboundrtpstreamstats rtcnetworktype rtcofferansw...
...es rtcrtpcodeccapability rtcrtpcodecparameters rtcrtpcontributingsource rtcrtpencodingparameters rtcrtpparameters rtcrtpreceiveparameters rtcrtpreceiver rtcrtpsendparameters rtcrtpsender rtcrtpstreamstats rtcrtpsynchronizationsource rtcrtptransceiver rtcrtptransceiverdirection rtcrtptransceiverinit rtcsctptransport rtcsessiondescription rtcsessiondescriptioncallback rtcstats rtcstatsicecandidatepairstate rtcstatsreport rtcstatstype rtctrackevent rtctrackeventinit radionodelist range readablebytestreamcontroller readablestream readablestreambyobreader readablestreambyobrequest readablestreamdefaultcontroller readablestreamdefaultreader relativeorientationsensor renderingcontext report reportingobserver reportingobserveroptions request requestdestination resizeobserver resize...
ARIA: Comment role - Accessibility
<p>the last half of the song is a slow-rising crescendo that peaks at the <span role="mark" aria-details="thread-1">end of the guitar solo</span>, before fading away sharply.</p> <div role="comment" id="thread-1" data-author="chris"> <h3>chris said</h3> <p class="comment-text">i really think this moment could use more cowbell.</p> <p><time datetime="2019-03-30t19:29">march 30 2019, 19:29</time></p> </div> to associate the comment with the text being commented, we need to wrap the commented text with an element containing the aria-details attribute, the value of which should be the id of the comment.
...multiple comments with the same annotation, like so: <p>the last half of the song is a slow-rising crescendo that peaks at the <mark aria-details="thread-1 thread-2">end of the guitar solo</mark>, before fading away sharply.</p> <div role="comment" id="thread-1" data-author="chris"> <h3>chris said</h3> <p class="comment-text">i really think this moment could use more cowbell.</p> <p><time datetime="2019-03-30t19:29">march 30 2019, 19:29</time></p> </div> <div role="comment" id="thread-2" data-author="chris"> <h3>marcus said</h3> <p class="comment-text">the guitar solo could do with a touch more chorus, and a slightly lower volume.</p> <p><time datetime="2019-03-29t15:35">march 29 2019, 15:35</time></p> </div> nested comments nested comments are also possible with aria anno...
...tations — simply nest the comments inside one another, like so: <div role="comment" id="thread-1" data-author="chris"> <h3>chris said</h3> <p class="comment-text">i really think this moment could use more cowbell.</p> <p><time datetime="2019-03-30t19:29">march 30 2019, 19:29</time></p> <div role="comment" data-author="marcus"> <h3>marcus replied</h3> <p class="comment-text">i don't know about that.
... i think the cowbell could distract from the solo.</p> <p><time datetime="2019-03-30t21:02">march 30 2019, 21:02</time></p> </div> </div> accessibility concerns landmark roles are intended to be used sparingly, to identify larger overall sections of the document.
An overview of accessible web applications and widgets - Accessibility
stock tickers, live twitter feed updates, progress indicators, and similar content modify the dom in ways that an assistive technology (at) may not be aware of.
...attribute-based selector for indicating state div.tooltip[aria-hidden="true"] { display: none; } the javascript to update the aria-hidden property has the form shown in example 2c.
... note that the script only updates the aria-hidden attribute (line 2); it does not need to also add or remove a custom classname.
...javascript to update the aria-checked attribute var showtip = function(el) { el.setattribute('aria-hidden', 'false'); } role changes aria allows developers to declare a semantic role for an element that otherwise offers incorrect or no semantics.
display - CSS: Cascading Style Sheets
WebCSSdisplay
al, sans-serif; letter-spacing: 1px; padding-top: 10px; } article { background-color: red; } article span { background-color: black; color: white; margin: 1px; } article, span { padding: 10px; border-radius: 7px; } article, div { margin: 20px; } javascript const articles = document.queryselectorall('.container'); const select = document.queryselector('select'); function updatedisplay() { articles.foreach((article) => { article.style.display = select.value; }); } select.addeventlistener('change', updatedisplay); updatedisplay(); result note: you can find more examples in the pages for each separate display data type, linked above.
... candidate recommendation added run-in, flow, flow-root, contents, and multi-keyword values.
... candidate recommendation added the grid box model values.
... candidate recommendation added the flexible box model values.
transition-delay - CSS: Cascading Style Sheets
-webkit-transition-property: width height background-color font-size left top color; -webkit-transition-duration:2s; -webkit-transition-delay:0.5s; -webkit-transition-timing-function: linear; transition-property: width height background-color font-size left top color; transition-duration:2s; transition-delay:0.5s; transition-timing-function: linear; } function updatetransition() { var el = document.queryselector("div.box"); if (el) { el.classname = "box1"; } else { el = document.queryselector("div.box1"); el.classname = "box"; } return el; } var intervalid = window.setinterval(updatetransition, 7000); transition-delay: 1s <div class="parent"> <div class="box">lorem</div> </div> .parent { width: 250px; height:125px;} .b...
...ute; -webkit-transition-property: width height background-color font-size left top color; -webkit-transition-duration:2s; -webkit-transition-delay:1s; -webkit-transition-timing-function: linear; transition-property: width height background-color font-size left top color; transition-duration:2s; transition-delay:1s; transition-timing-function: linear; } function updatetransition() { var el = document.queryselector("div.box"); if (el) { el.classname = "box1"; } else { el = document.queryselector("div.box1"); el.classname = "box"; } return el; } var intervalid = window.setinterval(updatetransition, 7000); transition-delay: 2s <div class="parent"> <div class="box">lorem</div> </div> .parent { width: 250px; height:125px;} .b...
...ute; -webkit-transition-property: width height background-color font-size left top color; -webkit-transition-duration:2s; -webkit-transition-delay:2s; -webkit-transition-timing-function: linear; transition-property: width height background-color font-size left top color; transition-duration:2s; transition-delay:2s; transition-timing-function: linear; } function updatetransition() { var el = document.queryselector("div.box"); if (el) { el.classname = "box1"; } else { el = document.queryselector("div.box1"); el.classname = "box"; } return el; } var intervalid = window.setinterval(updatetransition, 7000); transition-delay: 4s <div class="parent"> <div class="box">lorem</div> </div> .parent { width: 250px; height:125px;} .b...
...webkit-transition-property: width height background-color font-size left top color; -webkit-transition-duration:2s; -webkit-transition-delay:4s; -webkit-transition-timing-function: ease-in-out; transition-property: width height background-color font-size left top color; transition-duration:2s; transition-delay:4s; transition-timing-function: ease-in-out; } function updatetransition() { var el = document.queryselector("div.box"); if (el) { el.classname = "box1"; } else { el = document.queryselector("div.box1"); el.classname = "box"; } return el; } var intervalid = window.setinterval(updatetransition, 7000); specifications specification status comment css transitionsthe definition of 'transition-delay' in ...
transition-duration - CSS: Cascading Style Sheets
kit-transition-property: width height background-color font-size left top transform -webkit-transform color; -webkit-transition-duration:0.5s; -webkit-transition-timing-function: ease-in-out; transition-property: width height background-color font-size left top transform -webkit-transformv color; transition-duration:0.5s; transition-timing-function: ease-in-out; } function updatetransition() { var el = document.queryselector("div.box"); if (el) { el.classname = "box1"; } else { el = document.queryselector("div.box1"); el.classname = "box"; } return el; } var intervalid = window.setinterval(updatetransition, 7000); transition-duration: 1s <div class="parent"> <div class="box">lorem</div> </div> .parent { width: 250px; height:125px;}...
... -webkit-transition-property: width height background-color font-size left top -webkit-transform transform color; -webkit-transition-duration:1s; -webkit-transition-timing-function: ease-in-out; transition-property: width height background-color font-size left top transform -webkit-transform color; transition-duration:1s; transition-timing-function: ease-in-out; } function updatetransition() { var el = document.queryselector("div.box"); if (el) { el.classname = "box1"; } else { el = document.queryselector("div.box1"); el.classname = "box"; } return el; } var intervalid = window.setinterval(updatetransition, 7000); transition-duration: 2s <div class="parent"> <div class="box">lorem</div> </div> .parent { width: 250px; height:125px;}...
... -webkit-transition-property: width height background-color font-size left top transform -webkit-transform color; -webkit-transition-duration:2s; -webkit-transition-timing-function: ease-in-out; transition-property: width height background-color font-size left top transform -webkit-transform color; transition-duration:2s; transition-timing-function: ease-in-out; } function updatetransition() { var el = document.queryselector("div.box"); if (el) { el.classname = "box1"; } else { el = document.queryselector("div.box1"); el.classname = "box"; } return el; } var intervalid = window.setinterval(updatetransition, 7000); transition-duration: 4s <div class="parent"> <div class="box">lorem</div> </div> .parent { width: 250px; height:125px;}...
... -webkit-transition-property: width height background-color font-size left top transform -webkit-transform color; -webkit-transition-duration:4s; -webkit-transition-timing-function: ease-in-out; transition-property: width height background-color font-size left top transform -webkit-transform color; transition-duration:4s; transition-timing-function: ease-in-out; } function updatetransition() { var el = document.queryselector("div.box"); if (el) { el.classname = "box1"; } else { el = document.queryselector("div.box1"); el.classname = "box"; } return el; } var intervalid = window.setinterval(updatetransition, 7000); specifications specification status comment css transitionsthe definition of 'transition-duration' ...
Getting Started - Developer guides
ajax’s most appealing characteristic is its "asynchronous" nature, which means it can communicate with the server, exchange data, and update the page without having to refresh the page.
...you can see the test.xml here and the updated test script here.
...the idea would be that a server-side script of some kind would continually update the text file with new timestamps, and our xhr code would be used to report the latest timestamp on the client-side.
...l> <html> <head> <meta charset="utf-8"> <title>xhr log time</title> <style> </style> </head> <body> <p id="writedata" class="data">off-line</p> <p id="laststamp">no data yet</p> <script> const fulldata = document.getelementbyid('writedata'); const lastdata = document.getelementbyid('laststamp'); function fetchdata() { console.log('fetching updated data.'); let xhr = new xmlhttprequest(); xhr.open("get", "time-log.txt", true); xhr.onload = function() { updatedisplay(xhr.response); } xhr.send(); } function updatedisplay(text) { fulldata.textcontent = text; let timearray = text.split('\n'); // included because some file systems always include a blank line at the end of text f...
Cross-browser audio basics - Developer guides
timeupdate the timeupdate event is triggered every time the currenttime property changes.
... myaudio.addeventlistener("timeupdate", function() { //update something related to playback progress }); playing the playing event is initiated when playback is ready to start after having being paused due to lack of media data.
... displaycontrols(); }); } play.addeventlistener('click', function() { myaudio.play(); play.style.display = "none"; pause.style.display = "block"; }); pause.addeventlistener('click', function() { myaudio.pause(); pause.style.display = "none"; play.style.display = "block"; }); // display progress myaudio.addeventlistener('timeupdate', function() { //sets the percentage bar.style.width = parseint(((myaudio.currenttime / myaudio.duration) * 100), 10) + "%"; }); } you should end up with something like this: seeking using the seek bar this is a good start, but it would be nice to be able to navigate the audio using the progress bar.
... first of all, we apply a quick update to the progress bar css to display the hand pointer on hover: #progress { margin-left: 80px; border: 1px solid black; cursor: pointer; } then we add the code that detects the click and moves the 'playhead' to the correct position: var progress = document.getelementbyid('progress'); progress.addeventlistener('click', function(e) { // calculate the normalized position clicked var clickposition = (e.pagex - this.offsetleft) / this.offsetwidth; var clicktime = clickposition * myaudio.duration; // move the playhead to the correct position myaudio.currenttime = clicktime; }); buffering ok, we're getting there, but there is another piece of useful information we can display: the amou...
HTML attribute: min - HTML: Hypertext Markup Language
WebHTMLAttributesmin
valid for the numeric input types, including the date, month, week, time, datetime-local, number and range types, and the <meter> element, the min attribute is a number that specifies the most negative value a form control to be considered valid.
... syntax if any is not explicity set, valid values for the number, date/time input types, and range input types are equal to the basis for stepping - the min value and increments of the step value, up to the max value, if specified.
...for 4.2 to be valid, step would have had to be set to any, 0.1, 0.2, or any the min value would have had to be a number ending in .2, such as <input type="number" min="-5.2"> syntax for min values by input type input type example example date yyyy-mm-dd <input type="date" min="2019-12-25" step="1"> month yyyy-mm <input type="month" min="2019-12" step="12"> week yyyy-w## <input type="week" min="2019-w23" step=""> time hh:mm <input type="time" min="09:00" step="900"> datetime-local yyyy-mm-ddthh:mm <input type="datetime-local" min="2019-12-25t19:30"> number <n...
... if not explicitly included, step defaults to 1 for number and range, and 1 unit type (second, week, month, day) for the date/time input types.
<del>: The Deleted Text element - HTML: Hypertext Markup Language
WebHTMLElementdel
datetime this attribute indicates the time and date of the change and must be a valid date string with an optional time.
... if the value cannot be parsed as a date with an optional time string, the element does not have an associated time stamp.
... for the format of the string without a time, see date strings.
... the format of the string if it includes both date and time is covered in local date and time strings.
<hgroup> - HTML: Hypertext Markup Language
WebHTMLElementhgroup
ry heading (and with the same or similar punctuation before any other secondary headings an <hgroup> might be shown in a rendered outline in with the primary heading followed by parentheses around the secondary heading(s) consider the following html document: <!doctype html> <title>html standard</title> <body> <hgroup id="document-title"> <h1>html</h1> <h2>living standard — last updated 12 august 2016</h2> </hgroup> <p>some intro to the document.</p> <h2>table of contents</h2> <ol id=toc>...</ol> <h2>first section</h2> <p>some intro to the first section.</p> </body> a rendered outline for that document might look like the following: that is, the rendered outline might show the primary title, html, followed by a colon and space, followed by the secondary title, l...
...iving standard — last updated 12 august 2016.
... or, the rendered outline for that document might instead look like the following: that is, the rendered outline might show the primary title, html, followed by the secondary title shown in parentheses: (living standard — last updated 12 august 2016).
... examples <hgroup id="document-title"> <h1>html</h1> <h2>living standard — last updated 12 august 2016</h2> </hgroup> specifications specification status comment html living standardthe definition of '<hgroup>' in that specification.
<img>: The Image Embed element - HTML: Hypertext Markup Language
WebHTMLElementimg
on browsers supporting srcset, src is treated like a candidate image with a pixel density descriptor 1x, unless an image with this pixel density descriptor is already defined in srcset, or unless srcset contains w descriptors.
...the image referenced in the src attribute is counted as a 1x candidate in user agents that support srcset.
... using the html title attribute – updated | the paciello group technical summary content categories flow content, phrasing content, embedded content, palpable content.
... candidate recommendation added the referrerpolicy attribute.
<input type="number"> - HTML: Hypertext Markup Language
WebHTMLElementinputnumber
for example, let's give our example a minimum of 0, and a maximum of 100: <input type="number" placeholder="multiple of 10" step="10" min="0" max="100"> in this updated version, you should find that the up and down step buttons will not allow you to go below 0 or above 100.
... validation we have already mentioned a number of validation features of number inputs, but let's review them now: <input type="number"> elements automatically invalidate any entry that isn't a number (or empty, unless required is specified).
...(read, for example, the section on <input type="date"> validation.) important: html form validation is not a substitute for server-side scripts that ensure that the entered data is in the proper format!
... if your server-side code fails to validate the data it receives, disaster could strike when improperly-formatted data is submitted (or data which is too large, is of the wrong type, and so forth).
<input type="range"> - HTML: Hypertext Markup Language
WebHTMLElementinputrange
note: the following input attributes do not apply to the input range: accept, alt, checked, dirname, formaction, formenctype, formmethod, formnovalidate, formtarget, height, maxlength, minlength, multiple, pattern, placeholder, readonly, required, size, src, and width.
... as a rule, if the user is more likely to be interested in the percentage of the distance between minimum and maximum values than the actual number itself, a range input is a great candidate.
... range control mockups since browsers have this flexibility, and to date none support all of the features html defines for range controls, here are some mockups to show you what you might get on macos in a browser which supports them.
... html the html needs to be updated to wrap the <input> in a <div> to let us correct the layout after the transform is performed (since transforms don't automatically affect the layout of the page): <div class="slider-wrapper"> <input type="range" min="0" max="11" value="7" step="1"> </div> css now we need some css.
<input type="tel"> - HTML: Hypertext Markup Language
WebHTMLElementinputtel
unlike <input type="email"> and <input type="url"> , the input value is not automatically validated to a particular format before the form can be submitted, because formats for telephone numbers vary so much around the world.
...if your server-side code fails to validate the data it receives, disaster could strike when improperly-formatted data (or data which is too large, is of the wrong type, and so forth) is entered into your database.
... <input id="number2" name="number2" type="tel" required placeholder="second part" pattern="[0-9]{4}" aria-label="second part of number"> <span class="validity"></span> </span> </div> <div> <button>submit</button> </div> </form> the javascript is relatively simple — it contains an onchange event handler that, when the <select> value is changed, updates the <input> element's pattern, placeholder, and aria-label to suit the format of telephone numbers in that country/territory.
... it makes you wonder if it is worth going to all this trouble on the client-side, when you could just let the user enter their number in whatever format they wanted on the client-side and then validate and sanitize it on the server.
<ins> - HTML: Hypertext Markup Language
WebHTMLElementins
datetime this attribute indicates the time and date of the change and must be a valid date with an optional time string.
... if the value cannot be parsed as a date with an optional time string, the element does not have an associated time stamp.
... for the format of the string without a time, see format of a valid date string.
... the format of the string if it includes both date and time is covered in format of a valid local date and time string.
<video>: The Video Embed element - HTML: Hypertext Markup Language
WebHTMLElementvideo
the getstartdate() method can be used to determine the beginning point of the media timeline's reference frame.
... durationchange the duration attribute has been updated.
... timeupdate the time indicated by the currenttime attribute has been updated.
... addtype video/webm .webm your web host may provide an easy interface to mime type configuration changes for new technologies until a global update naturally occurs.
If-Modified-Since - HTTP
the if-modified-since request http header makes the request conditional: the server will send back the requested resource, with a 200 status, only if it has been last modified after the given date.
... if the request has not been modified since, the response will be a 304 without any body; the last-modified response header of a previous request will contain the date of last modification.
... the most common use case is to update a cached entity that has no associated etag.
...http dates are always expressed in gmt, never in local time.
If-None-Match - HTTP
note that the server generating a 304 response must generate any of the following header fields that would have been sent in a 200 (ok) response to the same request: cache-control, content-location, date, etag, expires, and vary.
...for example, two pages that differ by the date of generation in the footer would still be considered as identical.
... there are two common use cases: for get and head methods, to update a cached entity that has an associated etag.
... for other methods, and in particular for put, if-none-match used with the * value can be used to save a file not known to exist, guaranteeing that another upload didn't happen before, losing the data of the previous put; this problem is a variation of the lost update problem.
Intl.DisplayNames.supportedLocalesOf() - JavaScript
the intl.displaynames.supportedlocalesof() method returns an array containing those of the provided locales that are supported in date and time formatting without having to fall back to the runtime's default locale.
... return value an array of strings representing a subset of the given locale tags that are supported in date and time formatting without having to fall back to the runtime's default locale.
...the language tags returned are those for which the runtime supports a locale in date and time formatting that the locale matching algorithm used considers a match, so that it wouldn't have to fall back to the default locale.
... examples using supportedlocalesof assuming a runtime that supports indonesian and german but not balinese in date and time formatting, supportedlocalesof returns the indonesian and german language tags unchanged, even though pinyin collation is neither relevant to date and time formatting nor used with indonesian, and a specialized german for indonesia is unlikely to be supported.
Intl.ListFormat.supportedLocalesOf() - JavaScript
the intl.listformat.supportedlocalesof() method returns an array containing those of the provided locales that are supported in date and time formatting without having to fall back to the runtime's default locale.
... return value an array of strings representing a subset of the given locale tags that are supported in date and time formatting without having to fall back to the runtime's default locale.
...the language tags returned are those for which the runtime supports a locale in date and time formatting that the locale matching algorithm used considers a match, so that it wouldn't have to fall back to the default locale.
... examples using supportedlocalesof assuming a runtime that supports indonesian and german but not balinese in date and time formatting, supportedlocalesof returns the indonesian and german language tags unchanged, even though pinyin collation is neither relevant to date and time formatting nor used with indonesian, and a specialized german for indonesia is unlikely to be supported.
Intl.RelativeTimeFormat.supportedLocalesOf() - JavaScript
the intl.relativetimeformat.supportedlocalesof() method returns an array containing those of the provided locales that are supported in date and time formatting without having to fall back to the runtime's default locale.
... return value an array of strings representing a subset of the given locale tags that are supported in date and time formatting without having to fall back to the runtime's default locale.
...the language tags returned are those for which the runtime supports a locale in date and time formatting that the locale matching algorithm used considers a match, so that it wouldn't have to fall back to the default locale.
... examples using supportedlocalesof assuming a runtime that supports indonesian and german but not balinese in date and time formatting, supportedlocalesof returns the indonesian and german language tags unchanged, even though pinyin collation is neither relevant to date and time formatting nor used with indonesian, and a specialized german for indonesia is unlikely to be supported.
Web video codec guide - Web media technologies
motion compression of video typically works by comparing frames, finding where they differ, and constructing records containing enough information to update the previous frame to approximate the appearance of the following frame.
...looking closely, we can see that the majority of these differences come from a horizontal camera move, making this a good candidate for motion compensation.
...this makes vp8 a good candidate for your content, although vp9 is an even better choice if available to you.
...vp9 is one of the two video codecs mandated by webm (the other being vp8).
Animation performance and frame rate - Web Performance
for a rate of 60 frames per second, the browser has 16.7 milliseconds to execute scripts, recalculate styles and layout if needed, and repaint the area being updated.
... the process a browser uses to paint updated changes to a canvas element is different.
... when a canvas is animating a drawing, the canvas animation can be described as a waterfall consisting of the following steps: these sequenced need to fit into a single frame, since the screen isn't updated until it is complete.
... color properties that are rendered in their own layer don't even trigger a repaint, because the update is handled in composition.
x - SVG: Scalable Vector Graphics
WebSVGAttributex
candidate recommendation definition for <mask> scalable vector graphics (svg) 2the definition of 'x' in that specification.
... candidate recommendation definition as a geometry property scalable vector graphics (svg) 2the definition of 'x' in that specification.
... candidate recommendation definition for <pattern> scalable vector graphics (svg) 2the definition of 'x' in that specification.
... candidate recommendation definition for <text> and <tspan> scalable vector graphics (svg) 1.1 (second edition)the definition of 'x' in that specification.
y - SVG: Scalable Vector Graphics
WebSVGAttributey
candidate recommendation definition for <mask> scalable vector graphics (svg) 2the definition of 'y' in that specification.
... candidate recommendation definition as a geometry property scalable vector graphics (svg) 2the definition of 'y' in that specification.
... candidate recommendation definition for <pattern> scalable vector graphics (svg) 2the definition of 'y' in that specification.
... candidate recommendation definition for <text> and <tspan> scalable vector graphics (svg) 1.1 (second edition)the definition of 'y' in that specification.
Example - SVG: Scalable Vector Graphics
lns="http://www.w3.org/1999/xhtml" xmlns:svg="http://www.w3.org/2000/svg"> <head> <title>a swarm of motes</title> <style type='text/css'> <![cdata[ label, input { width: 150px; display: block; float: left; margin-bottom: 10px; } label { text-align: right; width: 75px; padding-right: 20px; } br { clear: left; } ]]> </style> </head> <body onload='update()'> <svg:svg id='display' width='400' height='300'> <svg:circle id='cursor' cx='200' cy='150' r='7' fill='#0000ff' fill-opacity='0.5'/> </svg:svg> <p>a swarm of motes, governed by two simple principles.
... mote.prototype.capposition = function() { var dims = dimensions(); if( this.x < 0 ) this.x = 0; else if( this.x >= dims[0] ) this.x = dims[0]-1; if( this.y < 0 ) this.y = 0; else if( this.y >= dims[1] ) this.y = dims[1]-1; } // mote::move() -- move a mote, update the screen.
...t.setattributens(null,'stroke','green'); this.elt.setattributens(null,'stroke-width','3'); this.elt.setattributens(null,'stroke-opacity','0.5'); display().appendchild( this.elt ); } this.elt.setattributens(null,'x1',old_x); this.elt.setattributens(null,'y1',old_y); this.elt.setattributens(null,'x2',this.x); this.elt.setattributens(null,'y2',this.y); } function update() { // first call?
... if( num == 0 ) motes = []; else if( motes.length > num ) motes = motes.slice(0,num-1); // move a random mote if( motes.length > 0 ) motes[ rand( motes.length ) ].move(); // and do this again in 1/100 sec settimeout('update()', 10); } ]]> </script> </body> </html> ...
Using custom elements - Web Components
ustom-square> the class constructor is really simple — here we attach a shadow dom to the element, then attach empty <div> and <style> elements to the shadow root: const shadow = this.attachshadow({mode: 'open'}); const div = document.createelement('div'); const style = document.createelement('style'); shadow.appendchild(style); shadow.appendchild(div); the key function in this example is updatestyle() — this takes an element, gets its shadow root, finds its <style> element, and adds width, height, and background-color to the style.
... function updatestyle(elem) { const shadow = elem.shadowroot; shadow.queryselector('style').textcontent = ` div { width: ${elem.getattribute('l')}px; height: ${elem.getattribute('l')}px; background-color: ${elem.getattribute('c')}; } `; } the actual updates are all handled by the life cycle callbacks, which are placed inside the class definition as methods.
... the connectedcallback() runs each time the element is added to the dom — here we run the updatestyle() function to make sure the square is styled as defined in its attributes: connectedcallback() { console.log('custom square element added to page.'); updatestyle(this); } the disconnectedcallback() and adoptedcallback() callbacks log simple messages to the console to inform us when the element is either removed from the dom, or moved to a different page: disconnectedcallback() { console.log('custom square element removed from page.'); } adoptedcallback() { console.log('custom square element moved to new page.'); } the attributechangedcallback() callback is run whenever one of the element's attributes is changed in some way.
...in this case however, we are just running the updatestyle() function again to make sure that the square's style is updated as per the new values: attributechangedcallback(name, oldvalue, newvalue) { console.log('custom square element attributes changed.'); updatestyle(this); } note that to get the attributechangedcallback() callback to fire when an attribute changes, you have to observe the attributes.
Caching compiled WebAssembly modules - WebAssembly
if the wasm module code is updated, or its url changes, you will need to update dbversion.
... any subsequent call to instantiatecachedurl() will then clear out the entire cache, allowing you to avoid using out-of-date modules.
...off by defining some necessary constants: function instantiatecachedurl(dbversion, url, importobject) { const dbname = 'wasm-cache'; const storename = 'wasm-cache'; setting up the database the first helper function contained inside instantiatecachedurl() — opendatabase() — creates an object store for storing wasm modules, and also handles clearing out the database if the dbversion is updated; it returns a promise resolving to the new database.
...bly.instantiatestreaming(fetch(url)).then(results => { return results.instance }); }); } caching a wasm module with the above library function defined, getting a wasm module instance and using its exported features (while handling caching in the background) is as simple as calling it with the following parameters: a cache version, which — as we explained above — you need to update when any wasm module is updated or moved to a different url.
XUL Migration Guide - Archive of obsolete content
first we'll outline how to decide whether your add-on is a good candidate for migration via a comparison of the benefits and limitations of the sdk versus xul development.
... if your add-on can accomplish everything it needs using only the supported apis, it's a good candidate for migration.
...it's a very simple add-on and a good candidate for porting because there are suitable sdk apis for all its features.
lang/type - Archive of obsolete content
isdate(value) returns true if value is a date, false otherwise.
... let { isdate } = require('sdk/lang/type'); isdate(new date()); // true isdate('3/1/2013'); // false parameters value : mixed the variable to check.
... returns boolean : boolean indicating if value is a date.
places/history - Archive of obsolete content
// we'd compose the query with the following options let lastweek = date.now - (1000*60*60*24*7); search( // first query looks for all entries before last week with 'ruby' [{ query: "ruby", to: lastweek }, // second query searches all entries after last week with 'javascript' { query: "javascript", from: lastweek }], // we want to order chronologically by visit date { sort: "date" } ).on("end", function (results) { // results is an array of objects cont...
...aining visit data, // sorted by visit date, with all entries from more than a week ago // that contain 'ruby', *in addition to* entries from this last week // that contain 'javascript' }); globals functions search(queries, options) queries can be performed on history entries by passing in one or more query options.
...possible options are 'title', 'date', 'url', 'visitcount', 'keyword', 'dateadded' and 'lastmodified'.
platform/xpcom - Archive of obsolete content
however, the components.classes object commonly used to look up factories by contract id will not be updated at run time.
...rvice using the getservice() api: var { class } = require('sdk/core/heritage'); var { unknown, service } = require('sdk/platform/xpcom'); var { cc, ci } = require('chrome'); var contractid = '@me.org/timestampedlogger'; // implement the service by subclassing unknown var timestampedlogger = class({ extends: unknown, get wrappedjsobject() this, log: function(message) { console.log(new date().gettime() + ' : ' + message); } }); // register the service using the contract id var service = service({ contract: contractid, component: timestampedlogger }); // access the service using getservice() var wrapper = cc[contractid].getservice(ci.nsisupports); var logger = wrapper.wrappedjsobject; logger.log('a timestamped message'); by default, services are registered and unregistered a...
... this function is similar to the standard components.classes[contractid] with one significant difference: that components.classes is not updated at runtime.
Displaying annotations - Archive of obsolete content
then in the module's scope implement a function to update the matcher's workers, and edit handlenewannotation to call this new function when the user enters a new annotation: function updatematchers() { matchers.foreach(function (matcher) { matcher.postmessage(simplestorage.storage.annotations); }); } function handlenewannotation(annotationtext, anchor) { var newannotation = new annotation(annotationtext, anchor); simplestorage.storage.ann...
...otations.push(newannotation); updatematchers(); } annotation panel the annotation panel just shows the content of an annotation.
... updating main.js finally, update main.js with the code to construct the annotation panel: var annotation = panels.panel({ width: 200, height: 180, contenturl: data.url('annotation/annotation.html'), contentscriptfile: [data.url('jquery-1.4.2.min.js'), data.url('annotation/annotation.js')], onshow: function() { this.postmessage(this.content); } }); execute cfx run one last time.
Multiple item extension packaging - Archive of obsolete content
<rdf xmlns="http://www.w3.org/1999/02/22-rdf-syntax-ns#" xmlns:nc="http://home.netscape.com/nc-rdf#" xmlns:em="http://www.mozilla.org/2004/em-rdf#"> <description about="urn:mozilla:install-manifest"> <!-- nsiupdateitem type for a multiple item package --> <em:type nc:parsetype="integer">32</em:type> ...
...<rdf xmlns="http://www.w3.org/1999/02/22-rdf-syntax-ns#" xmlns:em="http://www.mozilla.org/2004/em-rdf#"> <description about="urn:mozilla:install-manifest"> <!-- nsiupdateitem type for a multiple item package --> <em:type>32</em:type> ...
...if this is not done, any items that are not compatible will not be installed unless a compatibility check discovers updated compatibility information.
Appendix: What you should know about open-source software licenses - Archive of obsolete content
pros and cons programs that have been released under the gpl mandate that any derivative works also be released under the gpl, so the code cannot be wrapped in a proprietary program.
...this condition, which is commonly referred to as “copyleft,” mandates that any modification to the source code, or any new code combined with the source code, must be released under the same kind of license.
...(matsumoto updated his free software license diagnostic for a special open-source section in the january 2007 edition of softbank’s open source magazine.) if a company is considering releasing its own software as open source, it should consider dual-licensing or the cpl.
Adding menus and submenus - Archive of obsolete content
menu items are not dynamically updated while they are open.
... for example, you could have a menuitem that tells you the current time and is updated every second.
... on other systems you would be able to see the item update itself without having to close the menu and then reopen.
Mozilla Documentation Roadmap - Archive of obsolete content
mozilla blogs several mozilla community members maintain blogs that are updated frequently, often including information on api changes, bug fixes, useful tools and future release plans.
...it can be hard to follow due of the sheer mass of information coming out of it (dozens of posts per day), but you'll certainly be up to date with pretty much everything if you take the time to read at least part of it.
...this blog is maintained by the add-ons team at mozilla, and it's a great way to stay up to date with amo development and add-on review policies.
Useful Mozilla Community Sites - Archive of obsolete content
one of the main advantages of using amo is that it handles updates automatically for published add-ons.
... you just need to upload a new version of your extension, and once it's approved it will be pushed as an update to all your users.
... if you decide to host your own extension, you'll have to learn about the update system in order to push your own updates.
XPCOM Objects - Archive of obsolete content
this is generated from source, and it's kept relatively up to date.
... floating point float boolean boolean, prbool void void timestamps prtime this type is used to pass timestamps measured in milliseconds, such as the output of the gettime() method in a javascript date object.
...the only aspects to take into account are that methods and attributes must have the same names as their idl counterparts, and that the queryinterface method is implemented: queryinterface : function(aiid) { if (!aiid.equals(ci.xsihellocounter) && !aiid.equals(ci.nsisupports)) { throw cr.ns_error_no_interface; } return this; } the method is very simple, it validates that the caller is requesting a supported interface, otherwise it throws an exception.
An Interview With Douglas Bowman of Wired News - Archive of obsolete content
it was a no-brainer to us that wired news was a perfect candidate for the total conversion to xhtml and css.
...fortunately, our chief engineer was able to write some code that scraped through the database looking for errors like this which would invalidate our markup.
...meyer last updated date: october 11th, 2002 copyright information: 2001-2003 netscape ...
List of Former Mozilla-Based Applications - Archive of obsolete content
eloped name description additional information aphrodite browser inactive aol client for mac internet software no longer available beonex communicator internet software last news item on site from 2004 chameleon theme builder inactive civil netizen p2p file delivery (email attachment replacement) site not updated since 2006 compuserve client internet software no longer available doczilla sgml/xml/html browser last release on site from july 2005 fabula language learning application inactive galeon browser last news item on site from september 2006 gencatrss rss reader domain switched over to domain parking service ghostzil...
...t computers no longer available hp printer assistant printer utility hall of fame page mentions that this used an embedded version of mozilla at some point but i can't find reference to current status (may still be using mozilla code?) icebrowser java browser sdk uses mozilla rhino --eol'ed in 2009 (jin'sync) office app launcher download page last updated on 12/21/06 kylix compiler and integrated development environment borland discontinued this product.
... project pogo browser from at&t site no longer accessible as of may 2009 pyro desktop desktop environment last news item on site from july 2007 script editor editor inactive skipstone gtk+ browser last news item on site from february 2008 xabyl visual xbl editor inactive xulplayer media player last project update on 3/14/09 zoomcreator photo collage tool on april 29, 2010 the site announced zoomara was shutting down.
List of Mozilla-Based Applications - Archive of obsolete content
if you have information about a new project or extra information about an existing project, please feel free to update this page.
...amework designed for elderly people with dementia but other applications mac os x operating system makes use of some mpl files such as libsecurity_asn1 maemo browser browser for maemo internet tablet development name is microb magooclient business process management tool uses mozilla rhino mantra security tool mccoy secure update tool for add-ons xulrunner application mediacoder media converter transcoder for video, audio, and even devices such as zen, zune, pocketpcs, ipods, and psps mekhala browser part of the khmeros linux distro midbrowser mobile web browser mockery mockup creation tool built on xulrunner mongodb database project uses spide...
...widgets desktop widgets uses mozilla spidermonkey yoono desktop social networking app standalone version of yoono firefox add-on zap sip client status update from august 2008 zimbra desktop email and calendar application uses prism zinc video browser according to faq the standalone version is based on firefox zk web application framework makes use of xul zotero reference manager firefox extension and xulrunner application note: this page was previously hosted on mozpad.org and the hist...
Autodial for Windows NT - Archive of obsolete content
warning: the content of this article may be out of date.
... it was last updated in 2002.
... original document information author(s): benjamin chuang last updated date: october 2, 2002 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Creating a Firefox sidebar extension - Archive of obsolete content
warning: the content of this article may be out of date.
... since we are packaging the extension with a jar file, we need to update the chrome.manifest file to take to jar file into consideration: example 7.
... updated for firefox 2 - dec 12, 2006.
Enabling the behavior - updating the status periodically - Archive of obsolete content
now that we have code to retrieve tinderbox status and update the icon, we need to run it periodically.
... function loadtinderboxstatus() { gxmlhttprequest = new xmlhttprequest(); gxmlhttprequest.onload = updatetinderboxstatus; gxmlhttprequest.open("get", "http://tinderbox.mozilla.org/seamonkey/panel.html"); gxmlhttprequest.send(null); window.settimeout(loadtinderboxstatus, 60000); } window.settimeout(loadtinderboxstatus, 1000); window.settimeout schedules functions to run at some future time.
...this allows users to get relatively frequent updates about tinderbox without overloading the tinderbox server or slowing down mozilla with requests.
Creating a Mozilla Extension - Archive of obsolete content
warning: the content of this article may be out of date.
...see building an extension for an up-to-date tutorial (it focuses on firefox, but is also applicable to other new applications).
...he structure specifying the appearance enabling the behavior - retrieving tinderbox status enabling the behavior - updating the status bar panel enabling the behavior - updating the status periodically making it into a static overlay making it into a dynamic overlay and packaging it up for distribution conclusion next » original document information author(s): myk melez last updated date: september 19, 2006 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Creating a hybrid CD - Archive of obsolete content
warning: the content of this article may be out of date.
... it was last updated in 2001.
... original document information author(s): dawn endico last updated date: may 1, 2001 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Creating a Release Tag - Archive of obsolete content
warning: the content of this article may be out of date.
... it has not been updated for usage of mercurial.
...-name cvs | xargs -l -p10 cvs tag -l mozilla_0_9_4_1_release >& ../taglog original document information author(s): dawn endico last updated date: november 1, 2005 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Creating regular expressions for a microsummary generator - Archive of obsolete content
but to make it more robust, we should accommodate the possibility of variation in the query parameters.
... for example, the following is an equally valid url for the same auction item: http://cgi.ebay.com/ws/ebayisapi.dll?viewitem&foo=bar&item=170019463424 to accommodate these variations in query parameters, we can insert a period followed by an asterisk (.*) between "viewitem&" and "item=" to match any characters that might appear between those two strings: ^http://cgi\.ebay\.com/ws/ebayisapi\.dll\?viewitem&.*item= the period followed by an asterisk matches any combination of characters, including no characters at all, so it works even if "viewitem&" and "it...
...here's a url for the same item in that different style: http://cgi.ebay.com/mozilla-firefox-logo-1-inch-pin-badge-button-browser_w0qqitemz280018439106qqihz018qqcategoryz2036qqcmdzviewitem to accommodate these urls, we can create a second regular expression that matches them.
Block and Line Layout Cheat Sheet - Archive of obsolete content
if you know the answer, please pass it along to me so i can update the document.
... ll_understandsnwhitespace ll_textstartswithnbsp ll_firstletterstyleok ll_istopofpage ll_updatedband ll_impactedbyfloaters ll_lastfloaterwasletterframe ll_canplacefloater ll_knowstrictmode ll_instrictmode ll_lineendsinbr perframedata (why isn't this just stored in the frame?) mflags pfd_relativepos pfd_istextframe pfd_isnonemptytextframe pfd_isnonwhitespacetextframe pfd_isletterframe pfd_issticky pfd_isbullet perspandata in nslinelayout, a "span" is a con...
... original document information author(s): chris waterson last updated date: december 4, 2004 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Building Firefox with Rust code - Archive of obsolete content
if you don't have rust already, use the rustup tool to install it and update as new releases become available, or use the ./mach bootstrap command.
... cargo.lock files have also been checked in, so you will need to update those as well when appropriate.
... this works even if you use the existing vendored source location, but be aware that other vendor updates could clobber your patch in that case.
Document Loading - From Load Start to Finding a Handler - Archive of obsolete content
href="#nscategorymanager"> <area alt="nsdocumentopeninfo" coords="371,71,635,185" href="#nsdocumentopeninfo"> <area alt="necko" coords="721,113,821,157" href="#necko"> <area alt="nsuriloader" coords="23,335,215,455" href="#nsuriloader"> <area coords="227,515,485,575" href="#nsiuricontentlistener"> <area alt="nsdocshell" coords="47,83,203,153" href="#nsdocshell"></map> this block diagram is out of date as of january 2012 with regard to some minor control flow shuffling in nsuriloader.
... the prose description below has been updated.
... original document information author(s): boris zbarsky last updated date: october 24, 2003 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
HTTP Class Overview - Archive of obsolete content
warning: the content of this article may be out of date.
... it was last updated in 2002.
...derarray stores http "<header>:<value>" pairs nshttpauthcache stores authentication credentials for http auth domains nshttpbasicauth implements nsihttpauthenticator generates basic auth credentials from user:pass nshttpdigestauth implements nsihttpauthenticator generates digest auth credentials from user:pass original document information author(s): darin fisher last updated date: august 5, 2002 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Helper Apps (and a bit of Save As) - Archive of obsolete content
warning: the content of this article may be out of date.
... it was last updated in 2002.
... original document information author(s): boris zbarsky last updated date: september 12, 2002 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Introducing the Audio API extension - Archive of obsolete content
avoid using it and update existing code if possible; see the compatibility table at the bottom of this page to guide your decision.
... var prebuffersize = samplerate * 0.020; // initial buffer is 20 ms var autolatency = true, started = new date().valueof(); ...
... // auto latency detection if (autolatency) { prebuffersize = math.floor(samplerate * (new date().valueof() - started) / 1000); if (audio.mozcurrentsampleoffset()) { // play position moved?
Simple Storage - Archive of obsolete content
jetpack.future.import("menu");jetpack.future.import("selection");jetpack.future.import("storage.simple");// create the persistent notes array if it doesn't already exist.jetpack.storage.simple.notes = jetpack.storage.simple.notes || [];var notes = jetpack.storage.simple.notes;// updates the jetpack menu with the current notes.
... if there are no notes, we'll show a// disabled "(empty)" menuitem.function updatejetpackmenu() { jetpack.menu.set({ label: "notes", menu: new jetpack.menu(notes.length > 0 ?
...:(jetpack.menu.context.page.beforeshow = function (menu) { menu.reset(); if (jetpack.selection.text) menu.add({ label: "note", command: function () { notes.unshift(jetpack.selection.text); if (notes.length > 20) notes.pop(); updatejetpackmenu(); } });};// initialize the jetpack menu with the current notes.updatejetpackmenu(); see also settings jep 11 ...
Microsummary topics - Archive of obsolete content
in the future, firefox may access source urls to download updated versions of generators, so unless you are installing generators which are available from urls, you should not use this form for your programmatically-installed generators.
... differentiating between user-initiated and microsummary-related requests when firefox updates a microsummary generated by a microsummary generator add-on, it automatically downloads the html content of the page being summarized.
... controlling the frequency of microsummary requests when firefox downloads content in order to update a microsummary, it honors cache-related http response headers.
Migrate apps from Internet Explorer to Mozilla - Archive of obsolete content
var elm; if (ns4) elm = document.layers["myid"]; else if (ie4) elm = document.all["myid"] the above code isn't extensible, so if you want it to support a new browser, you must update these blocks throughout the web application.
... javascript date differences the only date difference is the getyear method.
... as per the ecmascript specification (which is the specification javascript follows), running new date().getyear() in 2004 will return "104".
File object - Archive of obsolete content
here is the original proposal for this object, and a status update from december 1998: http://www.mozilla.org/js/js-file-object.html created by the file constructor: new file(); new file(filename); parameters filename name of the file we want to work with.
... file.creationtime a date object representing the time when the file was created.
... file.lastmodified a date object representing the time when the file was last modified.
Table Layout Regression Tests - Archive of obsolete content
warning: the content of this article may be out of date.
... update the rtest.lst file in the corresponding directory in order to include your file.
... original document information author(s): bernd mielke other contributors: boris zbarsky last updated date: february 5, 2007 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
URIs and URLs - Archive of obsolete content
warning: the content of this article may be out of date.
... it was last updated in 2002.
... original document information author(s): andreas otte last updated date: january 2, 2002 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Attribute (XUL) - Archive of obsolete content
accesskeyextra1 buttonaccesskeyextra2 buttonaccesskeyhelp buttonalign buttondir buttondisabledaccept buttonlabelaccept buttonlabelcancel buttonlabeldisclosure buttonlabelextra1 buttonlabelextra2 buttonlabelhelp buttonorient buttonpack buttons checked checkstate clicktoscroll class closebutton closemenu coalesceduplicatearcs collapse collapsed color cols command commandupdater completedefaultindex container containment contentcontextmenu contenttooltip context contextmenu control crop curpos current currentset customindex customizable cycler datasources decimalplaces default defaultbutton defaultset description dir disableautocomplete disableautoselect disableclose disabled disablehistory disablekeynavigation disablesecurity dlgtype drag...
...dpanel max maxheight maxlength maxpos maxrows maxwidth member menu menuactive min minheight minresultsforpopup minwidth mode modifiers mousethrough movetoclick multiline multiple name negate newlines next noautofocus noautohide noinitialfocus nomatch norestorefocus object observes onbeforeaccept onbookmarkgroup onchange onclick onclosetab oncommand oncommandupdate ondialogaccept ondialogcancel ondialogclosure ondialogextra1 ondialogextra2 ondialoghelp onerror onerrorcommand onextra1 onextra2 oninput onload onnewtab onpageadvanced onpagehide onpagerewound onpageshow onpaneload onpopuphidden onpopuphiding onpopupshowing onpopupshown onsearchcomplete onselect ontextcommand ontextentered ontextrevert ontextreverted onunload onwiza...
...us showcaret showcommentcolumn showpopup size sizemode sizetopopup smoothscroll sort sortactive sortdirection sortresource sortresource2 spellcheck src state statedatasource statusbar statustext style subject substate suppressonselect tabindex tabscrolling targets template timeout title toolbarname tooltip tooltiptext tooltiptextnew top type uri useraction validate value var visuallyselected wait-cursor width windowtype wrap wraparound ...
Introduction to XUL - Archive of obsolete content
warning: the content of this article may be out of date.
... someday, there will be a complete description of this mechanism at packages, but for now there's a good but somewhat out of date document at configurable chrome available for more information.
... original document information author(s): danm@netscape.com last updated date: january 31, 2005 copyright information: copyright (c) danm@netscape.com ...
Adding more elements - Archive of obsolete content
first, we will add the capability to search for other information such as the file size and date.
... <hbox> <menulist id="searchtype"> <menupopup> <menuitem label="name"/> <menuitem label="size"/> <menuitem label="date modified"/> </menupopup> </menulist> <spacer style="width: 10px;"/> <menulist id="searchmode"> <menupopup> <menuitem label="is"/> <menuitem label="is not"/> </menupopup> </menulist> <spacer style="width: 10px;"/> <textbox id="find-text" flex="1" style="min-width: 15em;"/> </hbox> two drop down boxes have been added to the dialog.
...<spacer style="height: 10px"/> <hbox> <menulist id="searchtype"> <menupopup> <menuitem label="name"/> <menuitem label="size"/> <menuitem label="date modified"/> </menupopup> </menulist> <spacer style="width: 10px;"/> <menulist id="searchmode"> <menupopup> <menuitem label="is"/> <menuitem label="is not"/> </menupopup> </menulist> <spacer style="width: 10px;"/> <textbox id="find-text" flex="1" style="min-width: 15em;"/> </hbox> <spacer style="height: 10px" flex="1"/> <hbox> now when the dialog is resized, t...
Adding Properties to XBL-defined Elements - Archive of obsolete content
for example, the following field is given a default value equal to the current time: <field name="currenttime"> new date().gettime(); </field> properties sometimes you will want to validate the data that is assigned to a property.
...this script should store the value somewhere, or validate the value.
...use this to validate it or store it.
Install Scripts - Archive of obsolete content
for example, you may wish to check versions of files and only install updated files, or perhaps you wish to apply patches to existing files.
...when a new component is installed, the registry gets updated.
...that way, it is easier to check if a version of your component is already present and only update it if necessary.
Introduction to RDF - Archive of obsolete content
a bookmarks list contains a set of records, each with a set of data associated with it, such as a url, a bookmark title and a visited date.
...zilla bookmark list is described by the uris below: name http://home.netscape.com/nc-rdf#name bookmark name url http://home.netscape.com/nc-rdf#url url to link to description http://home.netscape.com/nc-rdf#description bookmark description last visited http://home.netscape.com/web-rdf#lastvisitdate date of last visit these are generated by taking a namespace name and appending the field name.
...note that the last visited date has a slightly different namespace than the other three.
The Implementation of the Application Object Model - Archive of obsolete content
warning: the content of this article may be out of date.
...because the file lives remotely, it can be updated whenever the owner of the web site sees fit.
...furthermore, should the content tree interfaces change, only this layer would need to be updated.
menuitem - Archive of obsolete content
attributes acceltext, accesskey, allowevents, autocheck, checked, closemenu, command, crop, description, disabled, image, key, label, name, selected, tabindex, type, validate, value properties accessibletype, accesskey, command, control, crop, disabled, image, label, labelelement, parentcontainer, selected, tabindex, value style classes menuitem-iconic, menuitem-non-iconic examples <menulist> <menupopup> <menuitem label="option 1" value="1"/> <menuitem label="option 2" value="2"/> <menuitem label="option 3" value="3"/> <menuitem label=...
... visible controls have a disabled property which, except for menus and menuitems, is normally preferred to use of the attribute, as it may need to update additional state.
... more information on adding checkmarks to menus in the xul tutorial validate type: one of the values below this attribute indicates whether to load the image from the cache or not.
menulist - Archive of obsolete content
for example, for a menuitem in a menu you can add the following css rule when you want to use the value none: menupopup > menuitem, menupopup > menu { max-width: none; } disableautoselect type: boolean if this attribute is true or omitted, the selected item on the menu will update to match what the user entered in the textbox.
...if this attribute is false, the selection is never updated to match the text box.
... visible controls have a disabled property which, except for menus and menuitems, is normally preferred to use of the attribute, as it may need to update additional state.
tab - Archive of obsolete content
ArchiveMozillaXULtab
attributes accesskey, afterselected, beforeselected, command, crop, disabled, first-tab, image, label, last-tab, linkedpanel, oncommand, pending, pinned, selected, tabindex, unread, validate, value properties accesskey, accessibletype, command, control, crop, disabled, image, label, linkedpanel, selected, tabindex, value examples (example needed) attributes accesskey type: character this should be set to a character that is used as a shortcut key.
... visible controls have a disabled property which, except for menus and menuitems, is normally preferred to use of the attribute, as it may need to update additional state.
... validate type: one of the values below this attribute indicates whether to load the image from the cache or not.
toolbarbutton - Archive of obsolete content
attributes accesskey, autocheck, checkstate, checked, command, crop, dir, disabled, dlgtype, group, image, label, oncommand, open, orient, tabindex, title, type, validate properties accesskey, accessibletype, autocheck, checkstate, checked, command, crop, dir, disabled, dlgtype, group, image, label, open, orient, tabindex, type examples <toolbar id="test-toolbar"> <toolbarbutton accesskey="p" label="plain"/> <toolbarbutton accesskey="c" label="checkbox" type="checkbox"/> <toolbarbutton accesskey="b" label="menu-button" type="menu-button"> <...
... visible controls have a disabled property which, except for menus and menuitems, is normally preferred to use of the attribute, as it may need to update additional state.
... examples: type value <toolbarbutton > menu menu-button checkbox radio validate type: one of the values below this attribute indicates whether to load the image from the cache or not.
XUL Explorer - Archive of obsolete content
option to automatically update the preview as the editor changes.
... simple xul checker can be used to ‘validate’ the xul snippet.
... installs latest version: install (windows): xulexplorer-1.0a1pre.en-us.win32.exe 6.6mb install (mac): xulexplorer-1.0a1pre.en-us.mac.dmg 9.3mb install (linux): xulexplorer-1.0a1pre.en-us.linux-i686.tar.bz2 8.4mb contributing source code in svn bugzilla (for bugs and suggestions) open bugs, enter new bug blog posts xul explorer - updated (1.0a1pre) xul explorer 0.4 xul explorer 0.3 xul explorer 0.2 exploring xul ...
2006-10-27 - Archive of obsolete content
summary: mozilla.dev.quality - october 20-october 27, 2006 announcements firefox & thunderbird 1.5.0.8 candidate builds available for testing!
... - with firefox 2.0 out the door, it's time to make sure that all 1.5.0.x users are updated with the latest and greatest in stability and security fixes!
... update welcome page - a bug has been discovered when updating to firefox 2.0.
NPN_ForceRedraw - Archive of obsolete content
description once a region of a windowless plugin has been invalidated with npn_invalidaterect() or npn_invalidateregion(), a plug-in can call npn_forceredraw() to force a paint message.
... this causes a synchronous update event or paint message for the plug-in.
...see also drawing and event handling npn_invalidaterect() npn_invalidateregion() npp_handleevent() npp ...
NPRegion - Archive of obsolete content
syntax windows: typedef hrgn npregion; mac os x: typedef rgnhandle npregion; note: this may need to be updated for the cocoa event model.
... xwindows: typedef region npregion; description npregion defines the region of the plug-in window to be updated, painted, invalidated, or clipped to.
...see also npn_forceredraw() npn_invalidaterect() npn_invalidateregion() npwindow nprect ...
Why RSS Slash is Popular - Counting Your Comments - Archive of obsolete content
an example using the most popular element of the rss slash module is shown below: <?xml version="1.0"> <rss version="2.0" xmlns:slash="http://purl.org/rss/1.0/modules/slash/" > <channel> <title>example</title> <description>an rss example with slash</description> <lastbuilddate>sun, 15 may 2005 13:02:08 -0500</lastbuilddate> <link>http://www.example.com</link> <item> <title>review of sin city</title> <guid>d77d2e80-0487-4e8c-a35d-a93f12a0ff7d:2005/05/15/114</guid> <pubdate>sun, 15 may 2005 13:02:08 -0500</lastbuilddate></pubdate> <link>http://www.example.com/blog/2005/05/15/114</link> ...
... <slash:comments>43</slash:comments> </item> <item> <title>what is the 3571st prime number</title> <guid>d77d2e80-0487-4e8c-a35d-a93f12a0ff7d:2005/05/15/113</guid> <pubdate>sun, 15 may 2005 10:55:12 -0500</lastbuilddate></pubdate> <link>d77d2e80-0487-4e8c-a35d-a93f12a0ff7d:2005/05/15/113</link> <slash:comments>72</slash:comments> </item> <item> <title>first article!</title> <guid>d77d2e80-0487-4e8c-a35d-a93f12a0ff7d:2005/05/15/112</guid> <pubdate>sun, 15 may 2005 08:14:11 -0500</lastbuilddate></pubdate> <link>http://www.example.com/blog/2005/05/15/112</link> <slash:comments>118</slash:comme...
...one could assume that the comment count was acurate at the moment in time specified in the <channel>'s <lastbuilddate> element, but that is a risky assumption given that no where is that mandated.
Digital Signatures - Archive of obsolete content
figure 1 shows a simplified view of the way a digital signature can be used to validate the integrity of signed data.
...to validate the integrity of the data, the receiving software first uses the signer's public key to decrypt the hash.
... original document information author(s): ella deon lackey last updated date: 2012 copyright information: © 2012 red hat, inc.
NSPR Release Engineering Guide - Archive of obsolete content
feature complete update ...pr/include/prinit.h with release numbers build all targets, debug and optimized on all platforms using local directories run the test suite on all targets verify release numbers show up in binaries resolve testing anomalies tag the tree with nsprpub_release_x_y_z_beta beta release checkout a whole new tree using the tag from above build all targets, debug and optimized on all platforms using the command: gmake release mdist=<dir>/mdist build_number=vx.y.z [build_opt=1 | use_debug_rtl=1] copy the bits from mdist to /share/builds/components/nspr20/.vx.y.z 1 run e...
...xplode.pl run the test suite on all targets, using binaries & headers from shipped bits resolve testing anomalies tag the tree with nsprpub_release_x_y[_z] release candidate checkout a whole new tree using tag (including fixes) tag the treey with nsprpub_release_x_y_z build all targets, debug and optimized on all platforms using the command: gmake release mdist=<dir>/mdist build_number=vx.y.z [build_opt=1 | use_debug_rtl=1] copy the bits from mdist to /share/builds/components/nspr20/.vx.y.z in /share/builds/components/nspr20/ run the following scripts: explode.pl rename.sh symlink.sh rtm bits rename the .vx.y.z directory to vx.y.z (remove the hidden directory 'dot').
... copy /share/builds/components/nspr20/vx.y.z/* to /share/systems/mozilla/pub/nspr/vx.y.z/ original document information author: larryh@netscape.com last updated date: september 20, 2000 1 copying files to /share/builds/components requires that one be logged on to a machine named "smithers" as user "svbld".
Threats - Archive of obsolete content
original document information author(s): ella deon lackey last updated date: 2012 copyright information: © 2012 red hat, inc.
... link: red hat certificate system common criteria certification 8.1: deployment, planning, and installation original document information author(s): joint task force transformation initiative title: national institute of standards and technology (nist) special publication 800-30 revision 1, guide for conducting risk assessments last updated date: september 2012 copyright information: this document is not subject to copyright.
... original document information author(s): karen scarfone, wayne jansen, and miles tracy title: national institute of standards and technology (nist) special publication 800-123, guide to general server security last updated date: july 2008 copyright information: this document is not subject to copyright.
Theme changes in Firefox 3 - Archive of obsolete content
this article covers the changes that need to be made to update a firefox theme to work properly in firefox 3.
... browser changes requiring theme updates there are a number of changed and deleted files in the browser that may require you to make changes to your theme.
... the table lists both the changed xul file and the theme's corresponding css file that you might need to update.
Processing XML with E4X - Archive of obsolete content
this node has one attribute, type, which can be accessed and updated in a number of ways: alert(languages.@type); // alerts "dynamic" languages.@type = "agile"; alert(languages.@type); // alerts "agile" alert(languages.tostring()); /* alerts: <languages type="agile"><lang>javascript</lang><lang>python</lang></languages> */ note that if one wishes to make comparisons of retrieved attributes with other strings, it is necessary to convert the attribute...
...syntax without needing to create a well-formed xml document, using the following syntax: var xmllist = <> <lang>javascript</lang> <lang>python</lang> </>; the += operator can be used to append new elements to an xmllist within a document: languages.lang += <lang>ruby</lang>; note that unlike node lists returned by regular dom methods, xmllists are static and are not automatically updated to reflect changes in the dom.
... if you create an xmllist as a subset of an existing xml object and then modify the original xml object, the xmllist will not reflect those changes; you will need to re-create it to get the most recent updates: var languages = <languages> <lang>javascript</lang> <lang>python</lang> </languages>; var lang = languages.lang; alert(lang.length()); // alerts 2 languages.lang += <lang>ruby</lang>; alert(lang.length()); // still alerts 2 lang = languages.lang; // re-create the xmllist alert(lang.length()); // alerts 3 searching and filtering e4x provides special operators for selecting nodes within a document that match specific criteria.
New in JavaScript 1.3 - Archive of obsolete content
--> new features in javascript 1.3 new globals nan infinity undefined new methods isfinite() function.prototype.call() function.prototype.apply() date.utc() date.prototype.getfullyear() date.prototype.setfullyear() date.prototype.getmilliseconds() date.prototype.setmilliseconds() date.prototype.getutcfullyear() date.prototype.getutcmonth() date.prototype.getutcdate() date.prototype.getutchours() date.prototype.getutcminutes() date.prototype.getutcseconds() date.prototype.getutcmilliseconds() date.prototype.toutcstring() date.protot...
...ype.setutcfullyear() date.prototype.setutcmonth() date.prototype.setutcdate() date.prototype.setutchours() date.prototype.setutcminutes() date.prototype.setutcseconds() date.prototype.setutcmilliseconds() other new features strict equality operators unicode support a javascript console was introduced.
... changed functionality in javascript 1.3 changes to date to conform with ecma-262 new constructor date(year, month, day, [,hours [, minutes [, seconds [, milliseconds ]]]]) additional method parameters: setmonth(month[, date]) sethours(hours[, min[, sec[, ms]]]) setminutes(min[, sec[, ms]]) setseconds(sec[, ms]) the length of an array (property length) is now an unsigned, 32-bit integer.
Standards-Compliant Authoring Tools - Archive of obsolete content
html-kit is a full-featured, low priced editor designed to help html, xhtml and xml authors to edit, format, lookup help, validate, preview and publish web pages.
...always be sure to validate your web pages.
... original document information last updated date: january 30th, 2003 copyright © 2001-2003 netscape.
XForms Select Element - Archive of obsolete content
characteristics analogous widgets are <html:select size="5" multiple="true"/> and <xul:listbox seltype="multiple"/> visual grouping by choices element isn't implemented if incremental attribute value is false, the bound node is updated when the select control is blurred (i.e.
... loses focus), otherwise it is updated upon item selection check group the select is represented as group of checkboxes (xhtml/xul).
... characteristics appearance attribute contains the value full there are no analogue widgets in xhtml or in xul visual grouping by choices element is supported if incremental attribute value is false then bound node is updated when item is blurred examples <xf:model> <xf:instance> <data xmlns=""> <values>g</values> </data> </xf:instance> </xf:model> <xf:select ref="/data/values" appearance="full"> <xf:choices> <xf:label>green colors</xf:label> <xf:item> <xf:label>pale green</xf:label> <xf:value>pg</xf:value> </xf:item> <xf:item> <xf:label>green</xf:label> <xf:value>g</xf:value> </xf:item> </xf:choices> <xf:choices> <xf:label>red colors</xf:label> <xf:item> <xf:label>red</xf:label> <xf:value>r</xf:va...
Fixing Incorrectly Sized List Item Markers - Archive of obsolete content
one solution is to move the rule into its own stylesheet, and accept that the stylesheet in question will never validate.
... this might also be a place to put any explorer-specific css-like rules (such as scrollbar styling rules), which also will not validate.
...meyer, netscape communications last updated date: published 04 oct 2002; revised 07 mar 2003 copyright information: copyright © 2001-2003 netscape.
Windows Media in Netscape - Archive of obsolete content
in ie, a named html element such as a div may be given to the windows media player control and it will be automatically updated with caption data.
...fortunately, windows media player also fires a scriptcommand() event for closed captioning, which means content may update the caption manually with a small piece of javascript.
... original document information authors: arun ranganathan, bob clary, ian oeschger last updated date: 30 jun 2003 copyright information: copyright © 2001-2003 netscape.
Archive of obsolete content
they are actually replaced by ''-(example removed)-'' the goal of this handbook is to help you update websites to work with standards-based browsers and properly detect gecko.
...if you have information about a new project or extra information about an existing project, please feel free to update this page.
... updating an extension to support multiple mozilla applications this article shows how to take an existing extension and update it so that it can be used in additional mozilla applications.
Building up a basic demo with PlayCanvas editor - Game development
as you can see, the file contains some boilerplate code already: pc.script.create('boxanimation', function (app) { // creates a new boxanimation instance var boxanimation = function (entity) { this.entity = entity; }; boxanimation.prototype = { // called once after all resources are loaded and before the first update initialize: function () { }, // called every frame, dt is time in seconds since last update update: function (dt) { } }; return boxanimation; }); the most interesting part is the update() function, which is where we can put any code that we want repeated on every frame.
...add this code to the initialize() function: this.timer = 0; and those two lines to the update() function: this.timer += dt; this.entity.setlocalscale(1, math.abs(math.sin(this.timer)), 1); the setlocalscale() method applies the given values to the x, y and z axes of the object.
... next, add the following line to the initialize() function: this.timer = 0; to move the cone up and down we will use the setposition() method — add the code below to the update() function: this.timer += dt; this.entity.setposition(2, math.sin(this.timer*2), 0); the position of the cone will be animated on each frame by being passed the math.sin() value of the timer at each point in time — we have doubled the this.timer value to make it move higher.
Audio for Web games - Game development
note: in many ways the concept of buffering is an outdated one.
...if you space your individual sounds by at least 500ms then using the timeupdate event (which fires every 250ms) should be sufficient.
...work: var myaudio = document.getelementbyid('myaudio'); var buttons = document.getelementsbytagname('button'); var stoptime = 0; for (var i = 0; i < buttons.length; i++) { buttons[i].addeventlistener('click', function() { myaudio.currenttime = this.getattribute("data-start"); stoptime = this.getattribute("data-stop"); myaudio.play(); }, false); } myaudio.addeventlistener('timeupdate', function() { if (this.currenttime > stoptime) { this.pause(); } }, false); note: you can try out our audio sprite player live on jsfiddle.
Desktop mouse and keyboard controls - Game development
dkey(phaser.keycode.s); to support both the cursor and w a s d keys, we need to do this: if(this.cursors.left.isdown || this.keyleft.isdown) { // move left } else if(this.cursors.right.isdown || this.keyright.isdown) { // move right } if(this.cursors.up.isdown || this.keyup.isdown) { // move up } else if(this.cursors.down.isdown || this.keydown.isdown) { // move down } in the update() function we can now move the player's ship in any direction using one of the two sets of movement key options.
...for w a s d keys it can be the space bar: this.keyfire1 = this.input.keyboard.addkey(phaser.keycode.x); this.keyfire2 = this.input.keyboard.addkey(phaser.keycode.spacebar); in the update() function we can easily check if any of those two were pressed on each frame: if(this.keyfire1.isdown || this.keyfire2.isdown) { // fire the weapon } if yes, then it's time to shoot some bullets!
... we can even define a secret cheat button: this.keycheat = this.input.keyboard.addkey(phaser.keycode.c); and then in the update() function whenever c is pressed we'll do this: if(this.keycheat.isdown) { this.player.health = this.player.maxhealth; } we can set the health of the player to maximum.
Collision detection - Game development
update the following part of the code as indicated by the highlighted line: var bricks = []; for(var c=0; c<brickcolumncount; c++) { bricks[c] = []; for(var r=0; r<brickrowcount; r++) { bricks[c][r] = { x: 0, y: 0, status: 1 }; } } next we'll check the value of each brick's status property in the drawbricks() function before drawing it — if status is 1, then draw it, but if it's ...
...update your drawbricks() function as follows: function drawbricks() { for(var c=0; c<brickcolumncount; c++) { for(var r=0; r<brickrowcount; r++) { if(bricks[c][r].status == 1) { var brickx = (c*(brickwidth+brickpadding))+brickoffsetleft; var bricky = (r*(brickheight+brickpadding))+brickoffsettop; bricks[c][r].x = brickx; bricks[c][r].y = bricky; ctx.beginpath(); ctx.rect(brickx, bricky, brickwidth, brickheight); ctx.fillstyle = "#0095dd"; ctx.fill(); ctx.closepath(); } } } } tracking and updating the status in the collision detec...
...update your collisiondetection() function as indicated below: function collisiondetection() { for(var c=0; c<brickcolumncount; c++) { for(var r=0; r<brickrowcount; r++) { var b = bricks[c][r]; if(b.status == 1) { if(x > b.x && x < b.x+brickwidth && y > b.y && y < b.y+brickheight) { dy = -dy; b.status = 0; } } } } } activating our collision detection the last thing to do...
Move the ball - Game development
updating the ball's position on each frame remember the update() function and its definition?
... the code inside it is executed on every frame, so it's a perfect place to put the code that will update the ball's position on screen.
... add the following new lines of the code inside update(), as shown: function update() { ball.x += 1; ball.y += 1; } the code above adds 1 to the x and y properties representing the the ball coordinates on the canvas, on each frame.
Gecko FAQ - Gecko Redirect 1
: html 4.0 - full support except for: elements: bdo, basefont attributes: shape attribute on the a element, abbr, axis, headers, scope-row, scope-col, scope-rowgroup, scope-colgroup, charoff, datasrc, datafld, dataformat, datapagesize, summary, event, dir, align on table columns, label attribute of option, alternate text of area elements, longdesc various metadata attributes: cite, datetime, lang, hreflang bidirectional text layout, which is only used in hebrew and arabic (ibm has begun work to add bidi support in a future release) style sheets css 1 - full support, except for: the application of styles to html column elements the ability to turn off author styles the names of certain mozilla extension pseudo-classes lack the moz- prefix ...
... xml 1.0: full support, except for processing to manipulate default attributes rdf: full support, except for abouteach, abouteachprefix, and parsetype javascript 1.5, including ecma-262 edition 3 (ecmascript) compliance, except for date.todatestring and date.totimestring, which are not implemented transfer protocols: http 1.1 (including gzip compression), ftp ssl unicode oji (open java interface) image formats png gif jpeg, pjpeg does "full support" mean that gecko has zero bugs today or will have zero bugs at some point in the future?
...here are some links to lists of reported bugs related to the standards mentioned above; be aware that these raw lists of open in-process bugs will inevitably include some duplicate, out of date, unreproducible, invalid, and incorrectly tagged reports: the links themselves are probably outdated too.
Cacheable - MDN Web Docs Glossary: Definitions of Web-related terms
note that some non-cacheable requests/responses to a specific uri may invalidate previously cached responses on the same uri.
... for example, a put to pagex.html will invalidate all cached get or head requests to the same uri.
...moreover, it invalidates cached data for request to the same uri done via head or get: put /pagex.html http/1.1 (…) 200 ok (…) a specific cache-control header in the response can prevent caching: get /pagex.html http/1.1 (…) 200 ok cache-control: no-cache (…) ...
CSS and JavaScript accessibility best practices - Learn web development
the rule of thumb is that you can update the styling of a page feature to fit in your design, but don't change it so much that it no longer looks or behaves as expected.
... modern javascript is a powerful language, and we can do so much with it these days, from simple content and ui updates to fully-fledged 2d and 3d games.
...we've used <label> elements to make sure the form labels are unambiguously linked to their inputs, so screen readers can read them out alongside: <label for="name">enter your name:</label> <input type="text" name="name" id="name"> we only do the validation when the form is submitted — this is so that we don't update the ui too often and potentially confuse screen reader (and possibly other) users: form.onsubmit = validate; function validate(e) { errorlist.innerhtml = ''; for(let i = 0; i < formitems.length; i++) { const testitem = formitems[i]; if(testitem.input.value === '') { errorfield.style.left = '360px'; createlink(testitem); } } if(errorlist.innerhtml !== '') { e...
Legacy layout methods - Learn web development
update the second css rule (with the .wrapper selector) as follows: body { width: 90%; max-width: 980px; margin: 0 auto; } .wrapper { padding-right: 2.08333333%; } not only have we given it a percentage width, we have also added a max-width property in order to stop the layout becoming too wide.
... next, update the fourth css rule (with the .col selector) like so: .col { float: left; margin-left: 2.08333333%; width: 6.25%; background: rgb(255, 150, 150); } now comes the slightly more laborious part — we need to update all our .col.span rules to use percentages rather than pixel widths.
... update the bottom block of css rules with the following: /* two column widths (12.5%) plus one gutter width (2.08333333%) */ .col.span2 { width: 14.58333333%; } /* three column widths (18.75%) plus two gutter widths (4.1666666) */ .col.span3 { width: 22.91666666%; } /* and so on...
Positioning - Learn web development
</p> now add the following rule to the bottom of your css: .positioned { position: static; background: yellow; } if you now save and refresh, you'll see no difference at all, except for the updated background color of the 2nd paragraph.
...go ahead and update the position declaration in your code: position: relative; if you save and refresh at this stage, you won't see a change in the result at all.
... now, update the body rule to remove the position: relative; declaration and add a fixed height, like so: body { width: 500px; height: 1400px; margin: 0 auto; } now we're going to give the <h1> element position: fixed;, and get it to sit at the top of the viewport.
Example 4 - Learn web development
.classlist.add('active'); }; function toggleoptlist(select, show) { var optlist = select.queryselector('.optlist'); optlist.classlist.toggle('hidden'); } function highlightoption(select, option) { var optionlist = select.queryselectorall('.option'); optionlist.foreach(function (other) { other.classlist.remove('highlight'); }); option.classlist.add('highlight'); }; function updatevalue(select, index) { var nativewidget = select.previouselementsibling; var value = select.queryselector('.value'); var optionlist = select.queryselectorall('.option'); nativewidget.selectedindex = index; value.innerhtml = optionlist[index].innerhtml; highlightoption(select, optionlist[index]); }; function getindex(select) { var nativewidget = select.previouselementsibling; ret...
...r', function (event) { deactivateselect(select); }); }); }); window.addeventlistener('load', function () { var selectlist = document.queryselectorall('.select'); selectlist.foreach(function (select) { var optionlist = select.queryselectorall('.option'), selectedindex = getindex(select); select.tabindex = 0; select.previouselementsibling.tabindex = -1; updatevalue(select, selectedindex); optionlist.foreach(function (option, index) { option.addeventlistener('click', function (event) { updatevalue(select, index); }); }); select.addeventlistener('keyup', function (event) { var length = optionlist.length, index = getindex(select); if (event.keycode === 27) { deactivateselect(select); } if (ev...
...ent.keycode === 40 && index < length - 1) { index++; } if (event.keycode === 38 && index > 0) { index--; } updatevalue(select, index); }); }); }); result ...
Example 5 - Learn web development
.classlist.add('active'); }; function toggleoptlist(select, show) { var optlist = select.queryselector('.optlist'); optlist.classlist.toggle('hidden'); } function highlightoption(select, option) { var optionlist = select.queryselectorall('.option'); optionlist.foreach(function (other) { other.classlist.remove('highlight'); }); option.classlist.add('highlight'); }; function updatevalue(select, index) { var nativewidget = select.previouselementsibling; var value = select.queryselector('.value'); var optionlist = select.queryselectorall('.option'); optionlist.foreach(function (other) { other.setattribute('aria-selected', 'false'); }); optionlist[index].setattribute('aria-selected', 'true'); nativewidget.selectedindex = index; value.innerhtml = optionli...
... form.classlist.remove("no-widget"); form.classlist.add("widget"); }); window.addeventlistener('load', function () { var selectlist = document.queryselectorall('.select'); selectlist.foreach(function (select) { var optionlist = select.queryselectorall('.option'), selectedindex = getindex(select); select.tabindex = 0; select.previouselementsibling.tabindex = -1; updatevalue(select, selectedindex); optionlist.foreach(function (option, index) { option.addeventlistener('mouseover', function () { highlightoption(select, option); }); option.addeventlistener('click', function (event) { updatevalue(select, index); }); }); select.addeventlistener('click', function (event) { toggleoptlist(select); }); ...
...ner('blur', function (event) { deactivateselect(select); }); select.addeventlistener('keyup', function (event) { var length = optionlist.length, index = getindex(select); if (event.keycode === 27) { deactivateselect(select); } if (event.keycode === 40 && index < length - 1) { index++; } if (event.keycode === 38 && index > 0) { index--; } updatevalue(select, index); }); }); }); result ...
How to structure a web form - Learn web development
the last one is an <input> element of type date, for entering the expiration date of the card; this one will come up with a date picker widget in supporting browsers, and fall back to a normal text input in non-supporting browsers.
... <option value="visa">visa</option> <option value="mc">mastercard</option> <option value="amex">american express</option> </select> </p> <p> <label for="number"> <span>card number:</span> <strong><abbr title="required">*</abbr></strong> </label> <input type="tel" id="number" name="cardnumber"> </p> <p> <label for="date"> <span>expiration date:</span> <strong><abbr title="required">*</abbr></strong> <em>formatted as mm/dd/yyyy</em> </label> <input type="date" id="date" name="expiration"> </p> </section> the last section we'll add is a lot simpler, containing only a <button> of type submit, for submitting the form data.
... add this to the bottom of your form now: <p> <button type="submit">validate the payment</button> </p> you can see the finished form in action below (also find it on github — see our payment-form.html source and running live): test your skills!
Adding vector graphics to the Web - Learn web development
bel { margin: 0; text-align: right; font-size: 0.7rem; width: 98%; } body { margin: 10px; background: #f5f9fa; } const textarea = document.getelementbyid('code'); const reset = document.getelementbyid('reset'); const solution = document.getelementbyid('solution'); const output = document.queryselector('.output'); let code = textarea.value; let userentry = textarea.value; function updatecode() { output.innerhtml = textarea.value; } reset.addeventlistener('click', function() { textarea.value = code; userentry = textarea.value; solutionentry = htmlsolution; solution.value = 'show solution'; updatecode(); }); solution.addeventlistener('click', function() { if(solution.value === 'show solution') { textarea.value = solutionentry; solution.value = 'hide solution...
...'; } else { textarea.value = userentry; solution.value = 'show solution'; } updatecode(); }); const htmlsolution = ''; let solutionentry = htmlsolution; textarea.addeventlistener('input', updatecode); window.addeventlistener('load', updatecode); // stop tab key tabbing out of textarea and // make it write a tab at the caret position instead textarea.onkeydown = function(e){ if (e.keycode === 9) { e.preventdefault(); insertatcaret('\t'); } if (e.keycode === 27) { textarea.blur(); } }; function insertatcaret(text) { const scrollpos = textarea.scrolltop; const caretpos = textarea.selectionstart; const front = (textarea.value).substring(0, caretpos); const back = (textarea.value).substring(textarea.selectionend, textarea.value.length); textarea.va...
...lue = front + text + back; caretpos = caretpos + text.length; textarea.selectionstart = caretpos; textarea.selectionend = caretpos; textarea.focus(); textarea.scrolltop = scrollpos; } // update the saved usercode every time the user updates the text area code textarea.onkeyup = function(){ // we only want to save the state when the user code is being shown, // not the solution, so that solution is not saved over the user code if(solution.value === 'show solution') { userentry = textarea.value; } else { solutionentry = textarea.value; } updatecode(); }; summary this article has provided you with a quick tour of what vector graphics and svg are, why they are useful to know about, and how to include svg inside your webpages.
HTML table advanced features and accessibility - Learn web development
caption { padding: 10px; } tbody { font-size: 90%; font-style: italic; } tfoot { font-weight: bold; } </style> </head> <body> <table> <caption>how i chose to spend my money</caption> <thead> <tr> <th>purchase</th> <th>location</th> <th>date</th> <th>evaluation</th> <th>cost (€)</th> </tr> </thead> <tfoot> <tr> <td colspan="4">sum</td> <td>118</td> </tr> </tfoot> <tbody> <tr> <td>haircut</td> <td>hairdresser</td> <td>12/09</td> <td>great idea</td> <td>30<...
...looking back to our spending record example from earlier on, you could unambiguously define the column headers as column headers like this: <thead> <tr> <th scope="col">purchase</th> <th scope="col">location</th> <th scope="col">date</th> <th scope="col">evaluation</th> <th scope="col">cost (€)</th> </tr> </thead> and each row could have a header defined like this (if we added row headers as well as column headers): <tr> <th scope="row">haircut</th> <td>hairdresser</td> <td>12/09</td> <td>great idea</td> <td>30</td> </tr> screenreaders will recognize markup structured like this, and allow their users ...
... returning to our spending costs example, the previous two snippets could be rewritten like this: <thead> <tr> <th id="purchase">purchase</th> <th id="location">location</th> <th id="date">date</th> <th id="evaluation">evaluation</th> <th id="cost">cost (€)</th> </tr> </thead> <tbody> <tr> <th id="haircut">haircut</th> <td headers="location haircut">hairdresser</td> <td headers="date haircut">12/09</td> <td headers="evaluation haircut">great idea</td> <td headers="cost haircut">30</td> </tr> ...
Choosing the right approach - Learn web development
single delayed operation repeating operation multiple sequential operations multiple simultaneous operations no yes no (unless it is the same one) no code example the following function creates a new date() object, extracts a time string out of it using tolocaletimestring(), and then displays it in the ui.
... we then run it once per second using setinterval(), creating the effect of a digital clock that updates once per second (see this live, and also see the source): function displaytime() { let date = new date(); let time = date.tolocaletimestring(); document.getelementbyid('demo').textcontent = time; } const createclock = setinterval(displaytime, 1000); pitfalls the frame rate isn't optimized for the system the animation is running on, and can be somewhat inefficient.
...this means millisecond precision and zero time as date.now().
Graceful asynchronous programming with Promises - Learn web development
adevices.getusermedia({video: true, audio: true}) .then(chatstream => { selfviewelem.srcobject = chatstream; chatstream.gettracks().foreach(track => mypeerconnection.addtrack(track, chatstream)); setstatusmessage("connected"); }).catch(err => { setstatusmessage("failed to connect"); }); } this function starts by using a function called setstatusmessage() to update a status display with the message "calling...", indicating that a call is being attempted.
...after that, the status display is updated to say "connected".
...this uses setstatusmessage() to update the status box to indicate that an error occurred.
Working with JSON - Learn web development
you should be careful to validate any data you are attempting to use (although computer-generated json is less likely to include errors, as long as the generator program is working correctly).
... you can validate json using an application like jsonlint.
...images, text, json, even html snippets), meaning that we can update small sections of content without having to reload the entire page.
Object prototypes - Learn web development
you'll see other examples of prototype chain inheritance all over javascript — try looking for the methods and properties defined on the prototype of the string, date, number, and array global objects, for example.
...this is really useful, but what is even more useful is that the whole inheritance chain has updated dynamically, automatically making this new method available on all object instances derived from the constructor.
...bye for now!'); }; but the farewell() method is still available on the person1 object instance — its members have been automatically updated to include the newly defined farewell() method.
Introduction to client-side frameworks - Learn web development
the real problem is this: every time we change our application’s state, we need to update the ui to match.
...if we add those features, we have to remember to update our ui in the right time and in the right way.
... modern web applications typically do not fetch and render new html files — they load a single html shell, and continually update the dom inside it (referred to as single page apps, or spas) without navigating users to new addresses on the web.
Componentizing our React app - Learn web development
once you’re done, the todo component's <input /> element will read like this: <input id="todo-0" type="checkbox" defaultchecked={props.completed} /> and your browser should update to show only eat being checked: if you change each <todo /> component’s completed prop, your browser will check or uncheck the equivalent rendered checkboxes accordingly.
...update your tasklist constant like so: const tasklist = props.tasks.map(task => ( <todo id={task.id} name={task.name} completed={task.completed} key={task.id} /> ) ); you should always pass a unique key to anything you render with iteration.
... then, update the return statement of app() so that it renders our components.
Creating our first Vue component - Learn web development
vue's data object if you change the value of the label prop passed into the <to-do-item></to-do-item> call in your app component, you should see it update.
... update the component object like so: export default { props: { label: { required: true, type: string }, done: { default: false, type: boolean } }, data() { return { isdone: this.done }; } }; vue does a little magic here — it binds all of your props directly to the component instance, so we don’t have to call this.props.done.
...update your <input> element now to replace checked="false" with :checked="isdone".
Implementing feature detection - Learn web development
update your <link> element in your html so it points to the correct css file (you should also update your <title> element to something more suitable!): <link href="modernizr-css.css" rel="stylesheet"> above this <link> element, add a <script> element to apply the modernizr library to the page, as shown below.
...if you look at the dom inspector of your browser's developer tools, you'll see that modernizr has updated your <html> class value like so: <html class="js no-htmlimports sizes flash transferables applicationcache blobconstructor blob-constructor cookies cors ...and loads more values!> it now contains a large number of classes that indicate the support status of different technology features.
... moving on, let's update our css to use modernizr rather than @supports.
Learn web development
if you prefer to copy the repo in a more flexible way that allows for automatic updates, you can follow the more complex instructions: install git on your machine.
... you can update the learning-area repository with any changes made to the master version on github with the following steps: in your command prompt/terminal, go inside the learning-area directory using cd.
... for example, if you were in the parent directory: cd learning-area update the repository using the following command: git pull contact us if you want to get in touch with us about anything, the best way is to drop us a message on our discourse forum.
Accessibility API cross-reference
all accessibility apis to date define a list of possible object roles, or general types, such as button, menu item, text, etc.
...all accessibility apis to date define a list of possible object roles, or general types, such as button, menu item, text, etc.
...ation) add missing aria properties fill out events cross reference table use this info to expand mozilla's accessibility api coverage to include mac, so that we can start to freeze them talk about the fact that msaa uses one interface (iaccessible), wherease gnome accessibility uses a lot of different interfaces depending on the type of object go through the atk info and make sure it's up-to-date accessible roles description & notes msaa role (role_system_*) java accessibility role gnome accessibility role (atk_role_*) mac os x accessibility role aria (role=*) html tagged pdf relevant xul for alerts, in java/gnome for any alert, in msaa if no other role applies.
What to do and what not to do in Bugzilla
bugs covered by this exception should not be invalidated by anyone other than the module owner or module peer; for bugs involving modules like layout or content, attach a test case to the bug and then cc one of the owners or peers.
... verifying wontfix or invalid bugs is relatively easy if a developer or a trusted qa person has wontfixed or invalidated them.
... bugs that were invalidated or wontfixed by someone else must be verified by a module owner or module peer or someone who has been explicitly told by a module owner or module peer that they are able to do so for that module.
Creating a Language Pack
this page is out of date.
... $ cd ../../../mozilla-aurora and update the source code to this revision.
... $ hg update -r 237dccbcb967 3 files updated, 0 files merged, 0 files removed, 0 files unresolved the source code has been updated to the revision the binary was built from.
How Mozilla's build system works
the primary job of configure is to determine characteristics of the system and compiler, apply options passed into it, and validate everything looks ok to build.
...0 created; 1 updated; 2187 unchanged total wall time: 5.03s; cpu time: 3.79s; efficiency: 75% what this is saying is that a total of 1,096 moz.build files were read.
...however, one was updated as a result of the new configuration.
Eclipse CDT Manual Setup
whenever you create a new workspace for a mozilla source tree, you should be sure to turn off the following two settings in the workspace preferences (window > preferences, or eclipse > preferences) before creating a project in that workspace: in "general > workspace", disable "build automatically" in "c/c++ > indexer", disable "automatically update the index" turning off automatic indexing prevents the cpu intensive indexer from running at various stages during the steps below before we're ready.
...:-) build option discovery this section requires that you have already built your mozilla source tree (so that you have an object directory for it), and it is strongly recommended that the object directory is up to date so that the just-print-mozilla-build.py script runs quickly.
...this script will complete in about 30 seconds on a warm tree (files cached in ram) if your object directory is up to date, although eclipse will take several minutes to process the "build output" that it produces.
Performance
store heavyweight state once per process bad: // addon.js var main = new myaddonservice(); main.onchange(statechange); function statechange() { services.mm.broadcastasyncmessage("my-addon:update-configuration", {newconfig: main.serialize()}) } // framescript.js var maincopy; function onupdate(message) { maincopy = myaddonservice.deserialize(message.data.newconfig); } addmessagelistener("my-addon:update-configuration", onupdate) // maincopy used by other functions the main issue here is that a separate object is kept for each tab.
... better: // addon.js var main = new myaddonservice(); main.onchange(statechange); function statechange() { services.ppmm.broadcastasyncmessage("my-addon:update-configuration", {newconfig: main.serialize()}) } // processmodule.jsm const exported_symbols = ['getmaincopy']; var maincopy; services.cpmm.addmessagelistener("my-addon:update-configuration", function(message) { maincopy = message.data.newconfig; }) funtion getmaincopy() { return maincopy; } // framescript.js components.utils.import("resource://my-addon/processmodule.jsm") // getmaincopy() used by other functions don't register observers (and other callbacks to global s...
... clean up on addon unload bad: all the previous examples, *even the "better" ones* if your addon is restartless or uses the sdk then updates or the user turning it off and on will load to unload/reload events.
Mozilla Content Localized in Your Language
formal and informal forms, and separators (, or .) date format what are the date formats for weeks and months are expressed in the following forms: 1)fully spelled out, 2).
... reference material can be find here calendar calendar view: which date is considered the first day of the week, sunday or monday?
...avoiding articles will help ensure that your translations will be accommodated within the user interface.
QA phase
to create and configure this file, follow these instructions: until the fix for bug 1063880 lands on mozilla-aurora and mozilla-beta when building language packs against those two trees you should: remove ac_add_options --disable-compile-environment from .mozconfig in step 3 use ./mach build config after step 4 update the mozilla source code: $ cd mozilla-aurora $ hg pull -u enter the following command to create the .mozconfig file: $ nano -w .mozconfig enter the following lines in your .mozconfig file: mk_add_options moz_objdir=@topsrcdir@/../firefox-build ac_add_options --disable-compile-environment ac_add_options --with-l10n-base=../l10n-central # path relative to moz_objdir ac_add_options --enable...
... enter the following command: $ hg log -l 1 you should see an output similar to the one below: changeset: 0:7c543e8f3a6a tag: tip user: your name <email@example.com> date: mon nov 23 18:08:25 2009 +0100 summary: added search bar strings now compare the local repository on your machine with the remote hg repository by entering this command: $ hg outgoing http://hg.mozilla.org/l10n-central/x-testing the hg outgoing command compares the two repositories and lists all changesets that are present locally, but not in the remote repository.
...you can expect to see output like this: comparing with http://hg.mozilla.org/l10n-central/x-testing searching for changes changeset: 0:7c543e8f3a6a tag: tip user: your name <email@example.com> date: mon nov 23 18:08:25 2009 +0100 summary: added search bar strings let's now push this changeset.
Uplifting a localization from Central to Aurora
the releases page on wikimo has the upcoming dates.
...you can safely push this to l10n-central already, in particular if you don't plan to do further updates on aurora.
...you can just throw your merge candidate away as long as you find fixes that you've forgotten on either aurora or beta, and address those in their own repos first.
Mozilla Port Blocking
warning: the content of this article may be out of date.
...ports enabled by protocol handlers in mozilla: protocol handler allowed ports ftp 21, 22 ldap 389, 636 nntp any port pop3 any port imap any port smtp any port finger 79 datetime 13 how to change mozilla port blocking permanently since each protocol can determine which ports are blocked, you should contact the protocol handler owner to request that a specific port be blocked or unblocked.
... more information nsioservice.cpp gbadportlist bug 83401 vulnerability note vu#476267 dougt@netscape.com original document information author(s): doug turner last updated date: august 15, 2007 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Mozilla Web Developer FAQ
here’s the check list: does the html document validate?
...on the other hand, mozilla’s quirks mode already accommodates common non-standardisms that are due to the behaviors of common legacy browsers.
... comp.infosystems.www.authoring.html web authoring faq comp.infosystems.www.authoring.stylesheets faq ciwas stylesheet authoring faq comp.lang.javascript faq original document information author(s): henri sivonen (please, no authoring questions to this address.) last updated date: may 12, 2007 copyright information: henri sivonen ...
A guide to searching crash reports
specifically, crash-stats offers two basic functions: searching you can search the crash reports database by over 100 criteria: crash signature, date, platform, product, version, etc.
...as the fine print says, the default date range is the past week.
... when a search is performed, the page's url is updated to include the search parameters.
L20n Javascript API
alternatively, you can register callbacks to execute when the context is ready (or when globals change and translations need to be updated) with ctx.localize.
... ctx.updatedata(ctxdata: object) update the context data which will be available to all entities in the context.
...in other words, the following two calls: ctx.updatedata({ user: { name: "bob" } }); ctx.updatedata({ user: { gender: "masculine" } }); will make the internally-stored context data look like this: { "user" : { "name": "bob", "gender": "masculine" } } ctx.getsync(id: string, ctxdata: object?) retrieve a string value of an entity called id.
Optimizing Applications For NSPR
these different declarations are to accommodate restrictions in watcom's c/c++ version 11.0 and 11.0a compiler.
...this problem has been resolved and an update will be appearing shortly.
... original document information author: larryh@netscape.com last updated date: december 1, 2004 ...
An overview of NSS Internals
there is a classic engine that is very stable and works fine in all simple scenarios, for example if all (b) candidate issuer certificates have the same subject and issuer names and differ by validity period; however, it works only in a limited amount of more advanced scenarios.
...as a result, when searching for a trust path from (a) to a trusted anchor (root) certificate (z), the set of candidate issuer certificates might have different issuer names (referring to the second or higher issuer level).
...create a context handle while providing all the parameters required for the operation, then call an “update” function multiple times to pass subsets of the input to nss.
Cryptography functions
updated 3.8 with new options.
... 3.9.3 and later pk11_pubencryptraw mxr 3.2 and later pk11_pubunwrapsymkey mxr 3.2 and later pk11_pubunwrapsymkeywithflags mxr 3.6 and later pk11_pubunwrapsymkeywithflagsperm mxr 3.9 and later pk11_pubwrapsymkey mxr 3.2 and later pk11_randomupdate mxr 3.2 and later pk11_readrawattribute mxr 3.9.2 and later pk11_referencesymkey mxr 3.2 and later pk11_resettoken mxr 3.4 and later pk11_restorecontext mxr 3.2 and later pk11_savecontext mxr 3.2 and later pk11_savecontextalloc ...
... 3.2 and later pk11_traverseslotcerts mxr 3.4 and later pk11_unlinkgenericobject mxr 3.9.2 and later pk11_unwrapsymkey mxr 3.2 and later pk11_unwrapsymkeywithflags mxr 3.2 and later pk11_unwrapsymkeywithflagsperm mxr 3.9 and later pk11_updateslotattribute mxr 3.8 and later pk11_userenableslot mxr 3.8 and later pk11_userdisableslot mxr 3.8 and later pk11_verify mxr 3.2 and later pk11_verifykeyok mxr 3.2 and later pk11_waitfortokenevent mxr 3.7 and later pk11_wrapsymkey ...
NSS 3.12.4 release notes
1434: avoid multiple encoding/decoding of pkix_pl_oid to and from ascii string bug 405297: problems building nss/lib/ckfw/capi/ with mingw gcc bug 420991: libpkix returns wrong nss error code bug 427135: add super-h (sh3,4) architecture support bug 431958: improve des and sha512 for x86_64 platform bug 433791: win16 support should be deleted from nss bug 449332: secu_parsecommandline does not validate its inputs bug 453735: when using cert9 (sqlite3) db, set or change master password fails bug 463544: warning: passing enum* for an int* argument in pkix_validate.c bug 469588: coverity errors reported for softoken bug 470055: pkix_httpcertstore_findsocketconnection reuses closed socket bug 470070: multiple object leaks reported by tinderbox bug 470479: io timeout during cert fetching makes libpk...
...om a p12 file leaves error code set to zero bug 492385: crash freeing named crl entry on shutdown bug 493135: bltest crashes if it can't open the input file bug 493364: can't build with --disable-dbm option when not cross-compiling bug 493693: sse2 instructions for bignum are not implemented on os/2 bug 493912: sqlite3_reset should be invoked in sdb_findobjectsinit when error occurs bug 494073: update rsa/dsa powerupself tests to be compliant for 2011 bug 494087: passing null as the value of cert_pi_trustanchors causes a crash in cert_pkixsetparam bug 494107: during nss_nodb_init(), softoken tries but fails to load libsqlite3.so crash [@ @0x0 ] bug 495097: sdb_mapsqlerror returns signed int bug 495103: nss_initreadwrite(sql:<dbdir>) causes nss to look for sql:<dbdir>/libnssckbi.so bug 495365: ...
...sshutdownlist.lock bug 507041: invalid build options for vc6 bug 507228: coreconf.dep doesn't need to contain the nss version number bug 507422: crash [[@ port_freearena - lg_mksecretkeyrep] when port_newarena fails bug 507482: nss 3.12.3 (and later) doesn't build on aix 5.1 bug 507937: pwdecrypt program problems bug 508259: pk11mode crashed on linux2.4 bug 508467: libpkix ocsp checker should use date argument to obtain the time for cert validity verification bug 510367: fix the utf8 characters in the nickname string for ac raíz certicamara s.a.
NSS 3.14 release notes
they should not use multi-part apis (c_encryptupdate/c_decryptupdate).
...applications may use this callback to inform libpkix whether or not candidate certificate chains meet application-specific security policies, allowing libpkix to continue discovering certificate paths until it can find a chain that satisfies the policies.
...ck (in certt.h) certchainverifycallbackfunc (in certt.h) cert_pi_chainverifycallback, a new option for certvalparamintype (in certt.h) a new error code: sec_error_application_callback_error (in secerr.h) new for pkcs #11 pkcs #11 mechanisms: ckm_aes_cts ckm_aes_ctr ckm_aes_gcm (see warnings against using c_encryptupdate/c_decryptupdate above) ckm_sha224_key_derivation ckm_sha256_key_derivation ckm_sha384_key_derivation ckm_sha512_key_derivation changes in nss 3.14 bug 333601 - performance enhancements for intel macs when building for intel macs, nss will now take advantage of optimized assembly code for common operations.
NSS 3.18.1 release notes
this is a patch release to update the list of root ca certificates.
...so, to give website administrators more time to update their web servers, we reverted the trust bits back to being enabled.
... cn=mcsholding test, o=mcsholding, c=eg sha1 fingerprint: e1:f3:59:1e:76:98:65:c4:e4:47:ac:c3:7e:af:c9:e2:bf:e4:c5:76 the version number of the updated root ca list has been set to 2.4 bugs fixed in nss 3.18.1 this bugzilla query returns all the bugs fixed in nss 3.18.1: https://bugzilla.mozilla.org/buglist.cgi?resolution=fixed&classification=components&query_format=advanced&product=nss&target_milestone=3.18.1 compatibility nss 3.18.1 shared libraries are backward compatible with all older nss 3.18 shared libraries.
NSS 3.48 release notes
bugs fixed in nss 3.48 bug 1600775 - require nspr 4.24 for nss 3.48 bug 1593401 - fix race condition in self-encrypt functions bug 1599545 - fix assertion and add test for early key update bug 1597799 - fix a crash in nssckfwobject_getattributesize bug 1591178 - add entrust root certification authority - g4 certificate to nss bug 1590001 - prevent negotiation of versions lower than 1.3 after helloretryrequest bug 1596450 - added a simplified and unified mac implementation for hmac and cmac behind pkcs#11 bug 1522203 - remove an old pentium pro performance workaround bug 15925...
...57 - fix prng known-answer-test scripts bug 1586176 - encryptupdate should use maxout not block size (cve-2019-11745) bug 1593141 - add `notbefore` or similar "beginning-of-validity-period" parameter to mozilla::pkix::trustdomain::checkrevocation bug 1591363 - fix a pbkdf2 memory leak in nsc_generatekey if key length > max_key_len (256) bug 1592869 - use arm neon for ctr_xor bug 1566131 - ensure sha-1 fallback disabled in tls 1.2 bug 1577803 - mark pkcs#11 token as friendly if it implements ckp_public_certificates_token bug 1566126 - power ghash vector acceleration bug 1589073 - use of new pr_assert_arg in certdb.c bug 1590495 - fix a crash in pk11_makecertfromhandle bug 1591742 - ensure des iv length is valid before usage from pkcs#11 bug 1588567 - enable mozilla::pkix gtests in ns...
...s ci bug 1591315 - update nsc_decrypt length in constant time bug 1562671 - increase nss mp kdf default iteration count, by default for modern key4 storage, optionally for legacy key3.db storage bug 1590972 - use -std=c99 rather than -std=gnu99 bug 1590676 - fix build if arm doesn't support neon bug 1575411 - enable tls extended master secret by default bug 1590970 - ssl_settimefunc has incomplete coverage bug 1590678 - remove -wmaybe-uninitialized warning in tls13esni.c bug 1588244 - nss changes for delegated credential key strength checks bug 1459141 - add more cbc padding tests that missed nss 3.47 bug 1590339 - fix a memory leak in btoa.c bug 1589810 - fix uninitialized variable warnings from certdata.perl bug 1573118 - enable tls 1.3 by default in nss this bugzilla query ret...
NSS 3.51.1 release notes
notable changes in nss 3.51.1 bug 1617968 - update delegated credentials implementation to draft-07.
... bug 1619056 - update readme: tls 1.3 is not experimental anymore.
... bug 1617968 - update delegated credentials implementation to draft-07.
NSS 3.51 release notes
notable changes in nss 3.51 updated dtls 1.3 implementation to draft-34.
... bugs fixed in nss 3.51 bug 1608892 - update dtls 1.3 implementation to draft-34.
...uaranteed to be null-terminated bug 1561337 - correct a warning for comparison of integers of different signs: 'int' and 'unsigned long' in security/nss/lib/freebl/ecl/ecp_25519.c:88 bug 1609751 - add test for mp_int clamping bug 1582169 - don't attempt to read the fips_enabled flag on the machine unless nss was built with fips enabled bug 1431940 - fix a null pointer dereference in blake2b_update bug 1617387 - fix compiler warning in secsign.c bug 1618400 - fix a openbsd/arm64 compilation error: unused variable 'getauxval' bug 1610687 - fix a crash on unaligned cmaccontext.aes.keyschedule when using aes-ni intrinsics this bugzilla query returns all the bugs fixed in nss 3.51: https://bugzilla.mozilla.org/buglist.cgi?resolution=fixed&classification=components&query_format=advanced...
Build instructions
these instructions are outdated.
... hg clone https://hg.mozilla.org/projects/nspr hg clone https://hg.mozilla.org/projects/nss if you want to build a releases other than the tips of these repositories, then switch to the release tags: cd nspr hg update nspr_4_9_5_rtm cd ../nss hg update nss_3_14_2_rtm cd ..
... to build with gcc on platforms other than linux and windows, you need to set two more environment variables: ns_use_gcc=1 no_mdupdate=1 for hp-ux, you must set the environment variable use_pthreads to 1.
Necko Interfaces Overview
warning: the content of this article may be out of date.
... it was last updated in 2001.
...epresents a physical connection, such as a file descriptor or a socket used directly by protocol handler implementations (as well as by mailnews and chatzilla) synchronous i/o methods: openinputstream, openoutputstream asynchronous i/o methods: asyncread, asyncwrite nsitransport::asyncread takes a nsistreamlistener parameter original document information author(s): darin fisher last updated date: december 10, 2001 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Rhino Debugger
when you select a stack frame the variables and watch windows are updated to reflect the names and values of the variables visible at that scope.
...the this table is updated each time control returns to the debugger or when you change the stack location in the context: window.
...the locals table is updated each time control returns to the debugger or when you change the stack location in the context: window watch window you may enter arbitrary javascript expressions in the watch: table located in the lower-right (dockable) pane in the debugger main window.
SpiderMonkey 1.8.7
the so-called "slow natives" are no longer supported; as such jsfastnative has been renamed to jsnative and relevant interfaces have been updated accordingly.
..._getsecuritycallbacks js_getstringcharsandlength js_getstringcharsz js_getstringcharszandlength js_getstringencodinglength js_haspropertybyid js_initctypesclass js_internjsstring js_isconstructing_possiblywithgiventhisobject js_isextensible js_isinrequest js_leavecrosscompartmentcall js_lookuppropertybyid js_lookuppropertywithflagsbyid js_new js_newcompartmentandglobalobject js_newdateobject js_newdateobjectmsec js_newfunctionbyid body new c++ helpers while jsapi remains a c api, the engine is now implemented in c++.
...the jsval_to_double and double_to_jsval macros have been updated to work directly on jsdoubles rather than their pointers, and the js_newdoublevalue and js_newdouble interfaces have been removed.
SpiderMonkey 24
get it here mozilla-esr24 if the download url is outdate you will find it in "firefox extended support release 24" package on hg release platform support spidermonkey 24 is supported on all the platforms where firefox 24 runs.
... new javascript language features javascript 24 includes significant updates to language features, yo.
... typedef changes the fixed-size integer types introduced in spidermonkey 17 are defined in one of the following ways (xxx update for msvc<10 deprecation): if the environment variable moz_custom_stdint_h is set, that file will be included to provide definitions for these types.
SpiderMonkey 31
the download url is outdated and spidermonkey not release alone!
... many jsclass and js::class instances are now explicitly const, and several apis have been updated to use const jsclass * and const js::class * pointers.
... new javascript language features javascript 31 includes significant updates to language features, yo.
SpiderMonkey 38
spidermonkey 38 is outdated and contains known security vulnerabilities.
... — sep 17, 2015 the download url is outdated and spidermonkey not release alone!
... new javascript language features javascript 38 includes significant updates to language features, yo.
SpiderMonkey 45
spidermonkey 45 is outdated and contains known security vulnerabilities.
... new javascript language features javascript 45 includes significant updates to its language features, yo.
...tions js_isgcmarkingtracer js_ismarkinggray js_idarraylength js_idarrayget js_destroyidarray js_defaultvalue js_getparent js_setparent js::parsepropertydescriptorobject js_deleteproperty2 js_deletepropertybyid2 js_deleteucproperty2 js_deleteelement2 js_newfunctionbyid js_bindcallable js_decompilefunctionbody js_getlatin1internedstringchars js_gettwobyteinternedstringchars js_newdateobjectmsec js_cleardatecaches changed apis js_init has moved from jsapi.h to js/initialization.h js_shutdown has moved from jsapi.h to js/initialization.h js_initreflect is now implicit js_addweakpointercallback is replaced with js_addweakpointerzonegroupcallback and js_addweakpointercompartmentcallback js_removeweakpointercallback is replaced with js_removeweakpointerzonegroupcallback a...
TPS Formdata Lists
date: the date the form data was used, expressed in hours from the present, so 0 means now, and -24 means 24 hours ago.
... for example: var formdata1 = [ { fieldname: "testing", value: "success", date: -1 }, { fieldname: "testing", value: "failure", date: -2 }, { fieldname: "username", value: "joe" } ]; formdata lists and phase actions you can use the following functions in phase actions for formdata lists: formdata.add formdata.delete formdata.verify formdata.verifynot for an example, see the tps formdata unittest: http://hg.mozilla.org/services/tps/f...st_formdata.js notes note 1, tps supports the delete action for formdata, but sync currently does not correctly sync deleted form data, see bug 564296.
... note 2, sync currently does not sync formdata dates, so the date field is ignored when performing verify and verify-not actions.
TPS History Lists
date: required.
... for example: var history_initial = [ { uri: "http://www.google.com/", title: "google", visits: [ { type: 1, date: 0 }, { type: 2, date: -1 } ] }, { uri: "http://www.cnn.com/", title: "cnn", visits: [ { type: 1, date: -1 }, { type: 2, date: -36 } ] }, ]; the history list used for deletions looks different.
...there are three different types: to delete all references to a specific page from history, use an object with a uri property to delete all references to all pages from a specific host, use an object with a host property to delete all history in a certain time period, use an object with begin and end properties, which should have integer values that express time since the present in hours (see date above) for example: var history_to_delete = [ { uri: "http://www.cnn.com/" }, { begin: -24, end: -1 }, { host: "www.google.com" } ]; history lists and phase actions history lists cannot be modified, they can only be added, deleted, and verified, using the following functions: history.add history.delete history.verify history.verifynot ...
Web Replay
replaying processes preserve all the same js behavior, dom structures, graphical updates, and most other behaviors that occurred while recording.
... messages describe actions the child process is able to do independently from the recording; currently this includes sending graphics updates, taking and restoring process snapshots, and responding to debugger requests.
... a child process can only pause at breakpoints and at snapshot points (currently these only happen when graphics updates are performed, at which point there is no js on the stack).
Signing Mozilla apps for Mac OS X
once the application has been signed, the signature of an application bundle can be validated by calling: codesign -vvvv application.app where application.app is the application bundle you wish to validate.
... the folder will fail to validate if any of these cases occur (there may be other cases not listed here): if any files that were included in the signature have been removed or modified if any files have been added to a folder that should have all files signed the coderesources file this file is located in your application's bundle at contents/_codesignature/coderesources.
...if any file is subsequently changed, the folder will no longer validate.
Retrieving part of the bookmarks tree
etfolders in your query object: query.setfolders([toolbarfolder], 1); run the query the executequery and executequeries functions will return an nsinavhistoryresult object containing the results of your query: var result = historyservice.executequery(query, options); get the results when you are querying for exactly one folder grouped by folder with no fancy query parameters such as keywords or date ranges (as in this example), the root of the result will be an nsinavhistorycontainerresultnode corresponding to your folder.
...as long as the container is open, it will listen for notifications from the bookmarks system to keep itself up-to-date.
...otherwise, it will continue to get observer notifications and update itself, slowing down the whole browser.
Using the Places livemark service
update behavior five seconds after the browser starts up, the livemark service's update timer is started.
... the update timer fires immediately, and then every 15 minutes thereafter.
... when the update timer fires, it iterates over the list of livemarks, and will refresh a livemark *only* if it's expired.
Observer Notifications
this is sent before browsingcontext::closed() is updated.
... topic data description places-autocomplete-feedback-updated sent when places updates the location bar's autocompletion display.
... lightweight-theme-styling-update json sent when the current theme being used is changed; this is sent even when the user is previewing a theme, not just when the theme is actually selected.
mozIRegistry
warning: the content of this article may be out of date.
...a corollary is that the build/install process will require updates to user "registry" to enable new class implementations to be accessible.
... original document information author: bill law last updated date: january 21, 1999 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
mozIVisitInfoCallback
toolkit/components/places/public/moziasynchistory.idlscriptable this interface provides callback handling functionality for moziasynchistory.updateplaces() 1.0 66 introduced gecko 2.0 inherits from: nsisupports last changed in gecko 9.0 (firefox 9.0 / thunderbird 9.0 / seamonkey 2.6) method overview void handleerror(in nsresult aresultcode, in moziplaceinfo aplaceinfo); void handleresult(in moziplaceinfo aplaceinfo); void oncomplete(in nsresult aresultcode, in moziplaceinfo aplaceinfo);obsolete since gecko 8.0 methods handleerror() called when a moziplaceinfo couldn't be processed.
... handleresult() called for each visit added, title change, or guid change when passed to moziasynchistory.updateplaces().
... oncomplete() obsolete since gecko 8.0 (firefox 8.0 / thunderbird 8.0 / seamonkey 2.5) called for each visit added, title change, or guid change when passed to moziasynchistory.updateplaces().
nsIAccessibleRole
it is used for date xforms:input.
... role_date_editor 69 represents control whose purpose is to allow a user to edit a date.
... role_calendar 113 a calendar that allows the user to select a date.
nsIAutoCompleteObserver
inherits from: nsisupports last changed in gecko 2.0 (firefox 4 / thunderbird 3.3 / seamonkey 2.1) method overview void onsearchresult(in nsiautocompletesearch search, in nsiautocompleteresult result); void onupdatesearchresult(in nsiautocompletesearch search, in nsiautocompleteresult result); methods onsearchresult() called when a search is complete and the results are ready.
... onupdatesearchresult() called to update with new results.
... void onupdatesearchresult( in nsiautocompletesearch search, in nsiautocompleteresult result ); parameters search the search object that processed this search.
nsIFeedEntry
published astring a string indicating the date on which the entry was published, in rfc822 format.
... this date is parsable by both javascript (via date.parse()) and mail code.
... note, that the related updated attribute is available from the nsifeedcontainer interface.
nsIFileView
if the treecol id is "filenamecolumn" fileview will return the file name, if the id is "lastmodifiedcolumn" it will return the date of last modification.
... sortdate 2 sort by the date of the last modification.
...mlns="http://www.mozilla.org/keymaster/gatekeeper/there.is.only.xul"> <tree flex="1" id="ftree"> <treecols> <-- the default column type is size unless an appropriate id is passed, nsifileview relies on the treecols section --> <treecol id="filenamecolumn" label="name" flex="1" primary="true"/> <treecol id="lastmodifiedcolumn" label="date" flex="1"/> <treecol id="size" label="size" flex="1"/> </treecols> <treechildren/> </tree> <script> var dir="/home/"; //the directory to be opened var ftree = document.getelementbyid("ftree"); //the xul tree element var lfile = components.classes["@mozilla.org/file/local;1"] .createinstance(components.interfaces.nsilocalfile); lfile.initwithpath(dir); // open the ...
nsIFrameLoader
void loaduri(in nsiuri auri); void sendcrossprocesskeyevent(in astring atype, in long akeycode, in long acharcode, in long amodifiers, [optional] in boolean apreventdefault); void sendcrossprocessmouseevent(in astring atype, in float ax, in float ay, in long abutton, in long aclickcount, in long amodifiers, [optional] in boolean aignorerootscrollframe); void updatepositionandsize(in nsiframe aiframe); native code only!
... native code only!updatepositionandsize updates the position and size of the subdocument loaded by this frameloader.
... void updatepositionandsize( in nsiframe aiframe ); parameters aiframe the nsiframe for the content node that owns this frameloader.
nsIHTMLEditor
avalue); void setcaretafterelement(in nsidomelement aelement); void setcssinlineproperty(in nsiatom aproperty, in astring aattribute, in astring avalue); void setdocumenttitle(in astring atitle); void setinlineproperty(in nsiatom aproperty, in astring aattribute, in astring avalue); void setparagraphformat(in astring aparagraphformat); void updatebaseurl(); attributes attribute type description iscssenabled boolean a boolean which is true is the htmleditor has been instantiated with css knowledge and if the css pref is currently checked.
... void setparagraphformat( in astring aparagraphformat ); parameters aparagraphformat "p", "h1" to "h6", "address", "pre", or "blockquote" updatebaseurl() set the baseurl for the document to the current url but only if the page doesn't have a <base> tag this should be done after the document url has changed, such as after saving a file this is used as base for relativizing link and image urls.
... void updatebaseurl(); parameters none.
nsILivemarkService
n nsiuri afeeduri); nsiuri getsiteuri(in long long container); boolean islivemark(in long long folder); void reloadalllivemarks(); void reloadlivemarkfolder(in long long folderid); void setfeeduri(in long long container, in nsiuri feeduri); void setsiteuri(in long long container, in nsiuri siteuri); void start(); void stopupdatelivemarks(); methods createlivemark() creates a new livemark.
... stopupdatelivemarks() stop the livemark refresh timer.
... void stopupdatelivemarks(); parameters none.
nsINavHistoryResultNode
dateadded prtime if the node is an item (bookmark, folder, or separator), this value is the time at which the item was created.
...note: when an item is added lastmodified is set to the same value as dateadded.
...even if you ask for all uris for a given date range long ago, this might contain today's date if the uri was visited today.
nsISupports proxies
the api has changed in mozilla 1.9, but the prose below hasn't been updated yet.
... see xpcom/proxy/public/nsiproxyobjectmanager.idl for the updated interface and its documentation.
...ns_release(ptestobj); pproxy->bar(); ns_release(pproxy); original document information author: doug turner last updated date: january 27, 2007 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
nsITaskbarPreview
method overview void invalidate(); attributes attribute type description active boolean indicates whether or not the preview is marked as active (currently selected) in the taskbar.
... methods invalidate() invalidates the taskbar's cached image of the preview, forcing a redraw if necessary.
... void invalidate(); parameters none.
nsITreeColumns
in gecko 1.9 (firefox 3) inherits from: nsisupports method overview nsitreecolumn getcolumnat(in long index); nsitreecolumn getcolumnfor(in nsidomelement element); nsitreecolumn getfirstcolumn(); nsitreecolumn getkeycolumn(); nsitreecolumn getlastcolumn(); nsitreecolumn getnamedcolumn(in astring id); nsitreecolumn getprimarycolumn(); nsitreecolumn getsortedcolumn(); void invalidatecolumns(); void restorenaturalorder(); attributes attribute type description count long the number of columns.
...invalidatecolumns() this method is called whenever a treecol is added or removed and the column cache needs to be rebuilt.
... void invalidatecolumns(); parameters none.
nsITreeSelection
inherits from: nsisupports last changed in gecko 1.9 (firefox 3) method overview void adjustselection(in long index, in long count); void clearrange(in long startindex, in long endindex); void clearselection(); void getrangeat(in long i, out long min, out long max); long getrangecount(); void invalidateselection(); void invertselection(); boolean isselected(in long index); void rangedselect(in long startindex, in long endindex, in boolean augment); void select(in long index); void selectall(); void timedselect(in long index, in long delay); void toggleselect(in long index); attributes attribute type description ...
...return value long - number of selection ranges invalidateselection() can be used to invalidate the selection.
... void invalidateselection(); parameters none.
nsIXFormsModelElement
1.0 66 introduced gecko 1.8 obsolete gecko 1.9.1 inherits from: nsisupports last changed in gecko 1.8 (firefox 1.5 / thunderbird 1.5 / seamonkey 1.0) method overview nsidomdocument getinstancedocument(in domstring instanceid); void rebuild(); void recalculate(); void refresh(); void revalidate(); methods getinstancedocument() nsidomdocument getinstancedocument( in domstring instanceid ); parameters instanceid the id of the instance element to be returned.
...revalidate() signals the xforms processor to perform a full revalidation of the given xforms model.
... void revalidate(); parameters none.
nsIXULRuntime
to get an instance, use: var xulruntime = components.classes["@mozilla.org/xre/app-info;1"] .getservice(components.interfaces.nsixulruntime); method overview void invalidatecachesonrestart(); attributes attribute type description accessibilityenabled boolean if true, the accessibility service is running.
... methods invalidatecachesonrestart() signal the apprunner to invalidate caches on the next restart.
... void invalidatecachesonrestart(); parameters none.
nsIXmlRpcClient
constants constant type description int unsigned long nsisupportsprint32 boolean unsigned long nsisupportsprbool string unsigned long nsisupportscstring double unsigned long nsisupportsdouble datetime unsigned long nsisupportsprtime array readonly unsigned long nsisupportsarray struct readonly unsigned long nsisupportsdictionary methods init() set server url.
...supported arguments are: nsisupportspruint8, nsisupportspruint16, nsisupportsprint16, nsisupportsprint32: i4, nsisupportsprbool: boolean, nsisupportschar, nsisupportscstring: string, nsisupportsfloat, nsisupportsdouble: double, nsisupportsprtime: datetime.iso8601, nsiinputstream: base64, nsisupportsarray: array, nsidictionary: struct note that both nsisupportsarray and nsidictionary can only hold any of the supported input types.
... return value will be converted as follows: i4 or int: nsisupportsprint32 boolean: nsisupportsprbool string: nsisupportscstring double: nsisupportsdouble datetime.iso8601: nsisupportsprtime base64: nsisupportscstring array: nsisupportsarray struct: nsidictionary faults (server side errors) are indicated by returning ns_error_failure.
nsIAbCard/Thunderbird3
same as home, but with `work' instead of `home' other contact: faxnumber, faxnumbertype pagernumber, pagernumbertype cellularnumber, cellularnumbertype jobtitle, department, company _aimscreenname dates: anniversaryyear, anniversarymonth, anniversaryday birthyear, birthmonth, birthday webpage1 (work), webpage2 (home) custom1, custom2, custom3, custom4 notes integral properties: lastmodifieddate popularityindex prefermailformat (see nsiabprefermailformat) boolean properties: allowremotecontent inherits from: nsiabitem method overview ...
... this will be removed from the interface at a later date.
... this will be removed from the interface at a later date.
XPCOM tasks
warning: the content of this article may be out of date.
... things we need to evangelize we need to keep up-to-date documentation, samples, and have brown-bags to keep people informed.
... original document information author(s): unknown last updated date: may 8, 2003 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
XPIDL
xpidl:syntax (now up to date again) xpidl syntax (out of date) xpidl author's guide (not as out of date) explanation of idl semantics a full guide to the syntax can be found at xpidl:syntax, which is written in an abnf form.
... in addition to this list, nearly every idl file includes nsrootidl.idl in some fashion, which also defines the following types: table 2: types provided by nsrootidl.idl idl typedef c++ in parameter c++ out parameter js type notes prtime (xpidl unsigned long long typedef, 64 bits) number prtime is in microseconds, while js date assumes time in milliseconds nsresult (xpidl unsigned long typedef, 32 bits) number nsrefcnt (xpidl unsigned long typedef, 32 bits) number size_t (xpidl unsigned long typedef, 32 bits) number voidptr void* void* not allowed charptr char* char** not allowed unicharptr char16_t* char1...
... resources (mostly outdated) some unsorted notes including a keyword list xpidl is a tool for generating c++ headers, java interfaces, xpconnect typelibs, and html documentation from xpidl files generating xpt files on windows a google groups post with instructions on how to use variable-length argument lists using xpidl.
Address book sync client design
warning: the content of this article may be out of date.
... it was imported from mozilla.org and last updated in 2000.
... // // step 1: // when the user begins a sync, run through the local database and update the // sync mapping table.
Building a Thunderbird extension 5: XUL
lloworld.xul within the content folder you created earlier with the following content: <?xml version="1.0"?> <overlay id="sample" xmlns="http://www.mozilla.org/keymaster/gatekeeper/there.is.only.xul"> <script type="application/javascript" src="chrome://myfirstext/content/overlay.js"/><!-- a reference to your javascript file --> <statusbar id="status-bar"> <statusbarpanel id="my-panel" label="date"/> </statusbar> </overlay> the <statusbar> widget named status-bar specifies the merge point within the application window that we want to attach to.
...in thunderbird it will appear as a label at the right side of thunderbird's statusbar and display "date".
...in the next section you will learn how to use javascript to modify your label so that it shows the current date.
Plugin Roadmap for Firefox - Plugins
adobe will stop shipping security updates for flash at the end of 2020.
... see also mozilla firefox october 2015 - npapi plugins in firefox july 2016 - reducing adobe flash usage in firefox july 2017 - firefox roadmap for flash end-of-life adobe flash november 2015 - flash, html5 and open web standards july 2017 - flash & the future of interactive content google chrome flash roadmap sep 2013 - saying goodbye to our old friend npapi may 2014 - update on npapi deprecation november 2014 - the final countdown for npapi august 2016 - flash and chrome december 2016 - roll-out plan for html5 by default july 2017 - saying goodbye to flash in chrome microsoft edge and internet explorer april 2016 - putting users in control of flash december 2016 - extending user control of flash with click-to-run july 2017 - flash on windows timeline august 2...
...019 - update on removing flash from microsoft edge and internet explorer apple safari june 2016 - next steps for legacy plug-ins july 2017 - adobe announces flash distribution and updates to end ...
Debugging service workers - Firefox Developer Tools
that last time the service worker was updated (if the service has not been updated, this is when it was first installed).
...this is very useful because, once registered, the service worker will not necessarily update to the new version immediately, which can make debugging a pain.
... these options make it much easier to remove a cache if it is required for testing a code update.
Migrating from Firebug - Firefox Developer Tools
try out css selectors firebug's selectors side panel provides a way to validate a css selector.
...the name, value, domain, path, expiration date and whether the cookie is http-only.
...additionally, the devtools allow to display the creation date of a cookie as well as when it was last accessed and whether it is host-only.
Animating CSS properties - Firefox Developer Tools
the css rendering waterfall the process the browser uses to update the page when a css property has changed can be described as a waterfall consisting of the following steps: recalculate style: every time a css property for an element changes, the browser must recalculate computed styles.
... this sequence needs to fit into a single frame, since the screen isn't updated until it is complete.
... color properties that are rendered in their own layer don't even trigger a repaint, because the update is handled in composition.
AddressErrors.city - Web APIs
syntax var cityerror = addresserrors.city; value if the value specified in the paymentaddress object's city property could not be validated, this property contains a domstring offering a human-readable explanation of the validation error and offers suggestions for correcting it.
... if the city value was validated successfully, this property is not included in the addresserrors object.
... candidate recommendation initial definition.
AudioParam.value - Web APIs
WebAPIAudioParamvalue
this is reflected by the value getter, which returns the value of the parameter as of the audio rendering engine's most recent render quantum, or moment at which audio buffers are processed and updated.
... in addition to processing audio buffers, each render quantum updates the value of each audioparam as needed given the current time and any established time-based parameter value changes.
... if any gradiated or ramped value changing methods have been called and the current time is within the time range over which the graduated change should occur, the value is updated based on the appropriate algorithm.
Battery Status API - Web APIs
navigator.getbattery().then(function(battery) { function updateallbatteryinfo(){ updatechargeinfo(); updatelevelinfo(); updatecharginginfo(); updatedischarginginfo(); } updateallbatteryinfo(); battery.addeventlistener('chargingchange', function(){ updatechargeinfo(); }); function updatechargeinfo(){ console.log("battery charging?
..."yes" : "no")); } battery.addeventlistener('levelchange', function(){ updatelevelinfo(); }); function updatelevelinfo(){ console.log("battery level: " + battery.level * 100 + "%"); } battery.addeventlistener('chargingtimechange', function(){ updatecharginginfo(); }); function updatecharginginfo(){ console.log("battery charging time: " + battery.chargingtime + " seconds"); } battery.addeventlistener('dischargingtimechange', function(){ updatedischarginginfo(); }); function updatedischarginginfo(){ console.log("battery discharging time: " + battery.dischargingtime + " seconds"); } }); see also the example in the specification.
... specifications specification status comment battery status api candidate recommendation initial definition.
CSSRule - Web APIs
WebAPICSSRule
13 cssdocumentrule cssrule.font_feature_values_rule 14 cssfontfeaturevaluesrule cssrule.viewport_rule 15 cssviewportrule cssrule.region_style_rule 16 cssregionstylerule cssrule.unknown_rule 0 cssunknownrule cssrule.charset_rule 2 csscharsetrule (removed in most browsers.) an up-to-date informal list of constants can be found on the csswg wiki.
... candidate recommendation added value counter_style_rule.
... candidate recommendation added value supports_rule.
Using the CSS properties and values API - Web APIs
the first is that, once a property is registered, there's no way to update it, and trying to re-register it with javascript will throw an error indicating it's already been defined.
... second, unlike standard properties, registered properties aren't validated when they're parsed.
... rather, they're validated when they're computed.
Cache - Web APIs
WebAPICache
in a serviceworker) handles cache updates.
... items in a cache do not get updated unless explicitly requested; they don’t expire unless deleted.
... console.log('deleting out of date cache:', cachename); return caches.delete(cachename); } }) ); }) ); }); self.addeventlistener('fetch', function(event) { console.log('handling fetch event for', event.request.url); event.respondwith( caches.open(current_caches.font).then(function(cache) { return cache.match(event.request).then(function(response) { if (response) { ...
A basic ray-caster - Web APIs
after every interval an update function will repaint the canvas showing the current view.
... so every update, the raycaster looks to see if you've pressed any keys lately, to conserve calculations by not casting if you're idle.
... if you have, then the canvas is cleared, the ground and sky are drawn, the camera position and/or orientation are updated, and the rays are cast out.
Document - Web APIs
WebAPIDocument
document.lastmodifiedread only returns the date on which the document was last modified.
... globaleventhandlers.ontimeupdate is an eventhandler representing the code to be called when the timeupdate event is raised.
... candidate recommendation extend the document interface page visibility (second edition)the definition of 'document' in that specification.
Element.shadowRoot - Web APIs
inside the <custom-square> element's class definition we include some life cycle callbacks that make a call to an external function, updatestyle(), which actually applies the size and color to the element.
... connectedcallback() { console.log('custom square element added to page.'); updatestyle(this); } attributechangedcallback(name, oldvalue, newvalue) { console.log('custom square element attributes changed.'); updatestyle(this); } in the updatestyle() function itself, we get a reference to the shadow dom using element.shadowroot.
... from here we use standard dom traversal techniques to find the <style> element inside the shadow dom and then update the css found inside it: function updatestyle(elem) { const shadow = elem.shadowroot; const childnodes = array.from(shadow.childnodes); childnodes.foreach(childnode => { if (childnode.nodename === 'style') { childnode.textcontent = ` div { width: ${elem.getattribute('l')}px; height: ${elem.getattribute('l')}px; background-color: ${elem.getattribute('c')}; } `; } }); } specifications specification status comment domthe definition of 'shadowroot' in that specification.
Gamepad.timestamp - Web APIs
WebAPIGamepadtimestamp
the gamepad.timestamp property of the gamepad interface returns a domhighrestimestamp representing the last time the data for this gamepad was updated.
... the idea behind this is to allow developers to determine if the axes and button data have been updated from the hardware.
...values are monotonically increasing, meaning that they can be compared to determine the ordering of updates, as newer values will always be greater than or equal to older values.
Using the Geolocation API - Web APIs
this initiates an asynchronous request to detect the user's position, and queries the positioning hardware to get up-to-date information.
... watching the current position if the position data changes (either by device movement or if more accurate geo information arrives), you can set up a callback function that is called with that updated position information.
...the callback function is called multiple times, allowing the browser to either update your location as you move, or provide a more accurate location as different techniques are used to geolocate you.
HTMLDialogElement.close() - Web APIs
syntax dialoginstance.close(returnvalue); parameters returnvalue optional a domstring representing an updated value for the htmldialogelement.returnvalue of the dialog.
...d="favanimal" name="favanimal"> <option></option> <option>brine shrimp</option> <option>red panda</option> <option>spider monkey</option> </select></p> </section> <menu> <button id="cancel" type="reset">cancel</button> <button type="submit">confirm</button> </menu> </form> </dialog> <menu> <button id="updatedetails">update details</button> </menu> <script> (function() { var updatebutton = document.getelementbyid('updatedetails'); var cancelbutton = document.getelementbyid('cancel'); var dialog = document.getelementbyid('favdialog'); dialog.returnvalue = 'favanimal'; function opencheck(dialog) { if(dialog.open) { console.log('dialog open'); ...
... } else { console.log('dialog closed'); } } // update button opens a modal dialog updatebutton.addeventlistener('click', function() { dialog.showmodal(); opencheck(dialog); }); // form cancel button closes the dialog box cancelbutton.addeventlistener('click', function() { dialog.close('animalnotchosen'); opencheck(dialog); }); })(); </script> note: you can find this example on github as htmldialogelement-basic (see it live also).
HTMLInputElement.stepDown() - Web APIs
valid on all numeric, date, and time input types that support the step attribute, includingdate, month, week, time, datetime-local, number, and range.
... <!-- decrements by intervals of 900 seconds (15 minute) --> <input type="time" max="17:00" step="900"> <!-- decrements by intervals of 7 days (one week) --> <input type="date" max="2019-12-25" step="7"> <!-- decrements by intervals of 12 months (one year) --> <input type="month" max="2019-12" step="12"> the method, when invoked, changes the form control's value by the value given in the step attribute, multiplied by the parameter, within the constraints set within the form control.
... if the form control is non time, date, or numeric in nature, and therefore does not support the step attribute (see the list of supported input types in the the table above), or if the step value is set to any, an invalidstateerror exception is thrown.
HTMLInputElement.stepUp() - Web APIs
input type default step value example step declaration date 1 (day) 7 day (one week) increments: <input type="date" min="2019-12-25" step="7"> month 1 (month) 12 month (one year) increments: <input type="month" min="2019-12" step="12"> week 1 (week) two week increments: <input type="week" min="2019-w23" step="2"> time 60 (seconds) 900 second (15 minute) increments: <input type="time" min="...
...09:00" step="900"> datetime-local 1 (day) same day of the week: <input type="datetime-local" min="019-12-25t19:30" step="7"> number 1 0.1 increments <input type="number" min="0" step="0.1" max="10"> range 1 increments by 2: <input type="range" min="0" step="2" max="10"> the method, when invoked, changes the form control's value by the value given in the step attribute, multiplied by the parameter, within the constraints set on the form control.
... if the form control is non time, date, or numeric in nature, and therefore does not support the step attribute (see the list of supported input types in the the table above), or if the step value is set to any, an invalidstateerror exception is thrown.
HTMLOutputElement - Web APIs
this is the empty string if the control is not a candidate for constraint validation (willvalidate is false), or it satisfies its constraints.
... htmloutputelement.willvalidateread only a boolean indicating whether the element is a candidate for constraint validation.
...if this message is not the empty string, then the element is suffering from a custom validity error, and does not validate.
HTMLSourceElement - Web APIs
note: if the src property is updated (along with any siblings), the parent htmlmediaelement's load method should be called when done, since <source> elements are not re-scanned automatically.
... htmlsourceelement.srcset is a domstring reflecting the srcset html attribute, containing a list of candidate images, separated by a comma (',', u+002c comma).
... a candidate image is a url followed by a 'w' with the width of the images, or an 'x' followed by the pixel density.
IDBRequest.readyState - Web APIs
example the following example requests a given record title, onsuccess gets the associated record from the idbobjectstore (made available as objectstoretitlerequest.result), updates one property of the record, and then puts the updated record back into the object store in another request.
...alk dog"; // open up a transaction as usual var objectstore = db.transaction(['todolist'], "readwrite").objectstore('todolist'); // get the to-do list object that has this title as it's title var objectstoretitlerequest = objectstore.get(title); objectstoretitlerequest.onsuccess = function() { // grab the data object returned as the result var data = objectstoretitlerequest.result; // update the notified value in the object to "yes" data.notified = "yes"; // create another request that inserts the item // back into the database var updatetitlerequest = objectstore.put(data); // log the source of this request console.log("the readystate of this request is " + updatetitlerequest.readystate); // when this new request succeeds, run the displaydata() // function again t...
...o update the display updatetitlerequest.onsuccess = function() { displaydata(); }; }; specifications specification status comment indexed database api 2.0the definition of 'readystate' in that specification.
IDBRequest.source - Web APIs
WebAPIIDBRequestsource
example the following example requests a given record title, onsuccess gets the associated record from the idbobjectstore (made available as objectstoretitlerequest.result), updates one property of the record, and then puts the updated record back into the object store in another request.
...walk dog"; // open up a transaction as usual var objectstore = db.transaction(['todolist'], "readwrite").objectstore('todolist'); // get the to-do list object that has this title as its title var objectstoretitlerequest = objectstore.get(title); objectstoretitlerequest.onsuccess = function() { // grab the data object returned as the result var data = objectstoretitlerequest.result; // update the notified value in the object to "yes" data.notified = "yes"; // create another request that inserts the item // back into the database var updatetitlerequest = objectstore.put(data); // log the source of this request console.log("the source of this request is " + updatetitlerequest.source); // when this new request succeeds, run the displaydata() // function again to update ...
...the display updatetitlerequest.onsuccess = function() { displaydata(); }; }; specifications specification status comment indexed database api 2.0the definition of 'source' in that specification.
IDBRequest.transaction - Web APIs
example the following example requests a given record title, onsuccess gets the associated record from the idbobjectstore (made available as objectstoretitlerequest.result), updates one property of the record, and then puts the updated record back into the object store in another request.
...alk dog"; // open up a transaction as usual var objectstore = db.transaction(['todolist'], "readwrite").objectstore('todolist'); // get the to-do list object that has this title as it's title var objectstoretitlerequest = objectstore.get(title); objectstoretitlerequest.onsuccess = function() { // grab the data object returned as the result var data = objectstoretitlerequest.result; // update the notified value in the object to "yes" data.notified = "yes"; // create another request that inserts the item back // into the database var updatetitlerequest = objectstore.put(data); // log the transaction that originated this request console.log("the transaction that originated this request is " + updatetitlerequest.transaction); // when this new request succeeds, run the di...
...splaydata() // function again to update the display updatetitlerequest.onsuccess = function() { displaydata(); }; }; this example shows how a the transaction property can be used during a version upgrade to access existing object stores:​ var openrequest = indexeddb.open('db', 2); console.log(openrequest.transaction); // will log "null".
KeyboardEvent.code - Web APIs
let shipsize = { width: 30, height: 30 }; let position = { x: 200, y: 200 }; let moverate = 9; let turnrate = 5; let angle = 0; let spaceship = document.getelementbyid("spaceship"); next comes the function updateposition().
... function updateposition(offset) { let rad = angle * (math.pi/180); position.x += (math.sin(rad) * offset); position.y -= (math.cos(rad) * offset); if (position.x < 0) { position.x = 399; } else if (position.x > 399) { position.x = 0; } if (position.y < 0) { position.y = 399; } else if (position.y > 399) { position.y = 0; } } the refresh() function handles applying the rotation and position ...
... window.addeventlistener("keydown", function(event) { if (event.defaultprevented) { return; // do nothing if event already handled } switch(event.code) { case "keys": case "arrowdown": // handle "back" updateposition(-moverate); break; case "keyw": case "arrowup": // handle "forward" updateposition(moverate); break; case "keya": case "arrowleft": // handle "turn left" angle -= turnrate; break; case "keyd": case "arrowright": // handle "turn right" angle += turnrate; break; } refresh(); // consume the event so i...
MerchantValidationEvent.complete() - Web APIs
the merchantvalidationevent method complete() takes merchant-specific information previously received from the validationurl and uses it to validate the merchant.
...another payment request is currently being processed, the current payment request is not currently being displayed to the user, or payment information is currently being updated.
... candidate recommendation initial definition.
MerchantValidationEvent - Web APIs
constructor merchantvalidationevent() secure context creates a new merchantvalidationevent object describing a merchantvalidation event that will be sent to the payment handler to request that it validate the merchant.
...once this data is retrieved, the data (or a promise resolving to the validation data) should be passed into complete() to validate that the payment request is coming from an authorized merchant.
... candidate recommendation initial definition.
Metadata.modificationTime - Web APIs
the read-only modificationtime property of the metadata interface is a date object which specifies the date and time the file system entry (or the data referenced by the entry) was last modified.a file system entry is considered to have been modified if the metadata or the contents of the referenced file (or directory, or whatever other kind of file system entry might exist on the platform in use) has changed.
... syntax var modificationtime = metadata.modificationtime; value a date timestamp indicating when the file system entry was last changed.
... workingdirectory.getfile("tmp/workfile.json", { create: true }, function(fileentry) { fileentry.getmetadata(function(metadata) { if ((new date().getfullyear() - metadata.modificationtime.getfullyear()) >= 5) { fileentry.remove(function() { workingdirectory.getfile("tmp/workfile.json", { create: true }, function(newentry) { fileentry = newentry; }); }); } }); }, handleerror); this api has no official w3c or whatwg specification.
PaymentCurrencyAmount.currencySystem - Web APIs
this obsolete property was removed in the may 3, 2018 update of the payment request api specification.
... candidate recommendation no longer part of the specification payment request api the definition of 'paymentcurrencyamount.currencysystem' in that specification.
... candidate recommendation the march 20, 2018 version of the specification; the last one to include this property ...
PaymentMethodChangeEvent - Web APIs
properties in addition to the properties below, this interface includes properties inherited from paymentrequestupdateevent.
... methods this interface includes methods inherited from paymentrequestupdateevent.
... candidate recommendation initial definition.
PaymentRequest.onshippingaddresschange - Web APIs
to make sure an updated address is included when sending payment information to the server, you should add event listeners for a paymentrequest object after instantiation, but before the call to show().
...var payment = new paymentrequest(supportedinstruments, details, options); request.addeventlistener('shippingaddresschange', function(evt) { evt.updatewith(new promise(function(resolve) { updatedetails(details, request.shippingaddress, resolve); })); }); payment.show().then(function(paymentresponse) { // processing of paymentresponse exerpted for the same of clarity.
... candidate recommendation initial definition.
PaymentRequest.onshippingoptionchange - Web APIs
to make sure an updated option is included when sending payment information to the server, you should add event listeners for a paymentrequest object after instantiation, but before the call to show().
...var request = new paymentrequest(supportedinstruments, details, options); // when user selects a shipping address request.addeventlistener('shippingaddresschange', e => { e.updatewith(((details, addr) => { var shippingoption = { id: '', label: '', amount: { currency: 'usd', value: '0.00' }, selected: true }; // shipping to us is supported if (addr.country === 'us') { shippingoption.id = 'us'; shippingoption.label = 'standard shipping in us'; shippingoption.amount.value = '0.00'; details.total.amount.value = '55.00'; // shipping to jp is supported } else if (addr.country === 'jp') { shippingoption.id = 'jp'; shippingoption.label = 'int...
... candidate recommendation initial definition.
performance.now() - Web APIs
WebAPIPerformancenow
syntax t = performance.now(); example const t0 = performance.now(); dosomething(); const t1 = performance.now(); console.log(`call to dosomething took ${t1 - t0} milliseconds.`); unlike other timing data available to javascript (for example date.now), the timestamps returned by performance.now() are not limited to one-millisecond resolution.
... also unlike date.now(), the values returned by performance.now() always increase at a constant rate, independent of the system clock (which might be adjusted manually or skewed by software like ntp).
... otherwise, performance.timing.navigationstart + performance.now() will be approximately equal to date.now().
PublicKeyCredential.response - Web APIs
in order to validate the creation of credentials, a relying party's server needs both: this response the extensions of the client (given by publickeycredential.getclientextensionresults()) to validate the demand.
... syntax response = publickeycredential.response value an authenticatorresponse object containing the data a relying party's script will receive and which should be sent to the relying party's server in order to validate the demand for creation or fetching.
... displayname: "john doe" }, pubkeycredparams: [ { type: "public-key", alg: -7 } ] }; navigator.credentials.create({ publickey: options }) .then(function (pubkeycredential) { var response = pubkeycredential.response; var clientextresults = pubkeycredential.getclientextensionresults(); // send response and client extensions to the server so that it can validate // and create credentials }).catch(function (err) { // deal with any error }); specifications specification status comment web authentication: an api for accessing public key credentials level 1the definition of 'response' in that specification.
RTCPeerConnection.createAnswer() - Web APIs
the answer contains information about any media already attached to the session, codecs and options supported by the browser, and any ice candidates already gathered.
...you should update any existing code to use the promise-based version of createanswer() instead.
... candidate recommendation initial definition.
RTCPeerConnection.createOffer() - Web APIs
the sdp offer includes information about any mediastreamtracks already attached to the webrtc session, codec, and options supported by the browser, and any candidates already gathered by the ice agent, for the purpose of being sent over the signaling channel to a potential peer to request a connection or to update the configuration of an existing connection.
...you should update any existing code to use the promise-based version of createoffer() instead.
... candidate recommendation initial definition.
RTCPeerConnection.onicegatheringstatechange - Web APIs
this happens when the ice gathering state—that is, whether or not the ice agent is actively gathering candidates—changes.
... example this example updates status information presented to the user to let them know what's happening by examining the current value of the icegatheringstate property each time it changes and changing the contents of a status display based on the new information.
... candidate recommendation initial specification.
RTCPeerConnection.restartIce() - Web APIs
the webrtc api's rtcpeerconnection interface offers the restartice() method to allow a web application to easily request that ice candidate gathering be redone on both ends of the connection.
...restarting ice essentially resets ice so that it creates all new candidates using new credentials.
... candidate recommendation initial definition.
RTCPeerConnection.signalingState - Web APIs
this provisional answer describes the supported media formats and so forth, but may not have a complete set of ice candidates included.
... further candidates will be delivered separately later.
... candidate recommendation initial specification.
RTCPeerConnection: signalingstatechange event - Web APIs
bubbles no cancelable no interface event event handler property rtcpeerconnection.onsignalingstatechange examples given an rtcpeerconnection, pc, and an updatestatus() function that presents status information to the user, this code sets up an event handler to let the user know when the ice negotiation process finishes up.
... pc.addeventlistener("signalingstatechange", ev => { switch(pc.signalingstate) { case "stable": updatestatus("ice negotiation complete"); break; } }, false); using onsignalingstatechange, it looks like this: pc.onsignalingstatechange = ev => { switch(pc.signalingstate) { case "stable": updatestatus("ice negotiation complete"); break; } }; specifications specification status comment webrtc 1.0: real-time communication between browsersthe definition of 'signalingstatechange' in that specification.
... candidate recommendation ...
RTCRtpSender.setParameters() - Web APIs
in other words, setparameters() updates the configuration of the rtp transmission as well as the encoding configuration for a specific media track on the webrtc connection.
... return value a promise that resolves when the rtcrtpsender.track property is updated with the given parameters.
... candidate recommendation initial definition.
RTCRtpStreamStats.qpSum - Web APIs
the qpsum property of the rtcrtpstreamstats dictionary is a value generated by adding the quantization parameter (qp) values for every frame sent or received to date on the video track corresponding to this rtcrtpstreamstats object.
... candidate recommendation initial definition.
... candidate recommendation initial definition.
RTCRtpStreamStats - Web APIs
note: this interface was called rtcrtpstreamstats until a specification update in the spring of 2017.
... qpsum the sum of the quantization parameter (qp) values associated with every frame received to date on the video track described by this rtcrtpstreamstats object.
... candidate recommendation initial definition.
SVGLength - Web APIs
WebAPISVGLength
setting this attribute will cause valueinspecifiedunits and valueasstring to be updated automatically to reflect this setting.
...setting this attribute will cause value and valueasstring to be updated automatically to reflect this setting.
...setting this attribute will cause value, valueinspecifiedunits, and unittype to be updated automatically to reflect this setting.
SVGTransformList - Web APIs
vgtransform getitem(in unsigned long index) svgtransform insertitembefore(in svgtransform newitem, in unsigned long index) svgtransform replaceitem(in svgtransform newitem, in unsigned long index) svgtransform removeitem(in unsigned long index) svgtransform appenditem(in svgtransform newitem) svgtransform createsvgtransformfrommatrix(in svgmatrix) svgtransform consolidate() properties readonly unsigned long numberofitems readonly unsigned long length normative document svg 1.1 (2nd edition) properties name type description numberofitems unsigned long the number of items in the list.
... consolidate() svgtransform consolidates the list of separate svgtransform objects by multiplying the equivalent transformation matrices together to result in a list consisting of a single svgtransform object of type svg_transform_matrix.
... candidate recommendation scalable vector graphics (svg) 1.1 (second edition)the definition of 'svgtransformlist' in that specification.
ServiceWorkerContainer - Web APIs
the serviceworkercontainer interface of the service worker api provides an object representing the service worker as an overall unit in the network ecosystem, including facilities to register, unregister and update service workers, and access the state of service workers and their registrations.
... methods serviceworkercontainer.register() creates or updates a serviceworkerregistration for the given scripturl.
... if (navigator.serviceworker.controller) { console.log('this page is currently controlled by:', navigator.serviceworker.controller); } // then, register a handler to detect when a new or // updated service worker takes control.
ShadowRoot - Web APIs
inside the <custom-square> element's class definition we include some life cycle callbacks that make a call to an external function, updatestyle(), which actually applies the size and color to the element.
... connectedcallback() { console.log('custom square element added to page.'); updatestyle(this); } attributechangedcallback(name, oldvalue, newvalue) { console.log('custom square element attributes changed.'); updatestyle(this); } in the updatestyle() function itself, we get a reference to the shadow dom using element.shadowroot.
... from here we use standard dom traversal techniques to find the <style> element inside the shadow dom and then update the css found inside it: function updatestyle(elem) { var shadow = elem.shadowroot; var childnodes = shadow.childnodes; for(var i = 0; i < childnodes.length; i++) { if(childnodes[i].nodename === 'style') { childnodes[i].textcontent = 'div {' + 'width: ' + elem.getattribute('l') + 'px;' + 'height: ' + elem.getattribute('l') + 'px;' + 'background-color: ' + elem.getattribute('c') + ';' + '}'; } } } specifications specification status comment domthe definition of 'interface shadowroot' in that specification.
Visual Viewport API - Web APIs
one thing that may not be clear in this example is the use of the pendingupdate flag and the call to requestanimationframe().
... the pendingupdate flag serves to prevent multiple invocations of the transfrom that can occur when onresize and onscroll fire at the same time.
... let pendingupdate = false; function viewporthandler(event) { if (pendingupdate) return; pendingupdate = true; requestanimationframe(() => { pendingupdate = false; var layoutviewport = document.getelementbyid('layoutviewport'); // since the bar is position: fixed we need to offset it by the // visual viewport's offset from the layout viewport origin.
WebGL2RenderingContext - Web APIs
webgl2renderingcontext.buffersubdata() updates a subset of a buffer object's data store.
... webgl2renderingcontext.invalidateframebuffer() invalidates the contents of attachments in a framebuffer.
... webgl2renderingcontext.invalidatesubframebuffer() invalidates portions of the contents of attachments in a framebuffer webgl2renderingcontext.readbuffer() selects a color buffer as the source for pixels.
WebGLRenderingContext.isEnabled() - Web APIs
gl.depth_test depth comparisons and updates to the depth buffer.
... gl.stencil_test stencil testing and updates to the stencil buffer.
... editor's draft updated definition for webgl 2.
Scissor animation - Web APIs
note that this time it is the position of the square (the scissoring area) that is updated every frame (we set frame rate to roughly one every 17ms, or roughly 60fps – frames per second).
... in contrast, the color of the square (set with clearcolor) is only updated when a new square is created.
...for each square, we set its color once, and then update only its position every frame.
Animating objects with WebGL - Web APIs
the first thing we'll need is a variable in which to track the current rotation of the square: var squarerotation = 0.0; now we need to update the drawscene() function to apply the current rotation to the square when drawing it.
...at the end of drawscene we add the code to update squarerotation.
... squarerotation += deltatime; this code uses the amount of time that's passed since the last time we updated the value of squarerotation to determine how far to rotate the square.
Using textures in WebGL - Web APIs
when the image has finished downloading // we'll update the texture with the contents of the image.
... updating the shaders the shader program also needs to be updated to use the textures instead of solid colors.
... the fragment shader the fragment shader likewise needs to be updated: const fssource = ` varying highp vec2 vtexturecoord; uniform sampler2d usampler; void main(void) { gl_fragcolor = texture2d(usampler, vtexturecoord); } `; instead of assigning a color value to the fragment's color, the fragment's color is computed by fetching the texel (that is, the pixel within the texture) based on the value of vtexturecoord which like the color...
Lifetime of a WebRTC session - Web APIs
each peer establishes a handler for icecandidate events, which handles sending those candidates to the other peer over the signaling channel.
... descriptions, candidates, etc.
... if you need to change the configuration of the connection in some way (such as changing to a different set of ice servers), you can do so before restarting ice by calling rtcpeerconnection.setconfiguration() with an updated rtcconfiguration dictionary before restarting ice.
Inputs and input sources - Web APIs
it calls a function applyexternalinputs() which we'll define momentarily; it takes the avatar object and uses its information to update the avatar's reference frame.
... after that, everything proceeds as usual, getting the viewer's pose from the updated reference frame, requesting the next frame callback through requestanimationframe(), and then continuing to set up webgl and draw the scene.
... the applyexternalinputs() method takes the avatar object replaces its referencespace property with a new reference space that incorporates the updated deltas.
Movement, orientation, and motion: A WebXR example - Web APIs
viewmatrix: gl.getuniformlocation(shaderprogram, 'umodelviewmatrix'), normalmatrix: gl.getuniformlocation(shaderprogram, 'unormalmatrix'), usampler: gl.getuniformlocation(shaderprogram, 'usampler') }, }; buffers = initbuffers(gl); texture = loadtexture(gl, 'https://cdn.glitch.com/a9381af1-18a9-495e-ad01-afddfd15d000%2ffirefox-logo-solid.png?v=1575659351244'); xrsession.updaterenderstate({ baselayer: new xrwebgllayer(xrsession, gl) }); if (session_type == "immersive-vr") { refspacetype = "local"; } else { refspacetype = "viewer"; } mat4.fromtranslation(cubematrix, viewerstartposition); vec3.copy(cubeorientation, viewerstartorientation); xrsession.requestreferencespace(refspacetype) .then((refspace) => { xrreferencespace = refspace.ge...
...we connect the session to the webgl layer so it konws what to use as a rendering surface by calling xrsession.updaterenderstate() with a baselayer set to a new xrwebgllayer.
...in either case, the label of the button is updated to indicate that a click will start a session, and then, if there is a pending request for an animation frame, we cancel it by calling cancelanimationframe once that's done, the value of xrsession is changed to null to indicate that we're done with the session.
Advanced techniques: Creating and sequencing audio - Web APIs
ol these using range inputs on the interface: <label for="attack">attack</label> <input name="attack" id="attack" type="range" min="0" max="1" value="0.2" step="0.1" /> <label for="release">release</label> <input name="release" id="release" type="range" min="0" max="1" value="0.5" step="0.1" /> now we can create some variables over in javascript and have them change when the input values are updated: let attacktime = 0.2; const attackcontrol = document.queryselector('#attack'); attackcontrol.addeventlistener('input', function() { attacktime = number(this.value); }, false); let releasetime = 0.5; const releasecontrol = document.queryselector('#release'); releasecontrol.addeventlistener('input', function() { releasetime = number(this.value); }, false); the final playsweep() functio...
...ll do that in the same sort of way as before: <label for="rate">rate</label> <input name="rate" id="rate" type="range" min="0.1" max="2" value="1" step="0.1" /> let playbackrate = 1; const ratecontrol = document.queryselector('#rate'); ratecontrol.addeventlistener('input', function() { playbackrate = number(this.value); }, false); the final playsample() function we'll then add a line to update the playbackrate property to our playsample() function.
... while (nextnotetime < audioctx.currenttime + scheduleaheadtime ) { schedulenote(currentnote, nextnotetime); nextnote(); } timerid = window.settimeout(scheduler, lookahead); } we also need a draw function to update the ui, so we can see when the beat progresses.
Using the Web Audio API - Web APIs
we'll use the factory method in our code: const gainnode = audiocontext.creategain(); now we have to update our audio graph from before, so the input is connected to the gain, then the gain node is connected to the destination: track.connect(gainnode).connect(audiocontext.destination); this will make our audio graph look like this: the default value for gain is 1; this keeps the current volume the same.
... so let's grab this input's value and update the gain value when the input node has its value changed by the user: const volumecontrol = document.queryselector('#volume'); volumecontrol.addeventlistener('input', function() { gainnode.gain.value = this.value; }, false); note: the values of node objects (e.g.
... great, now the user can update the track's volume!
Web Storage API - Web APIs
stores data with no expiration date, and gets cleared only through javascript, or clearing the browser cache / locally stored data.
...when you choose different options, the page is instantly updated; in addition your choices are stored in localstorage, so that when you leave the page then load it again later on your choices are remembered.
... in addition, we have provided an event output page — if you load this page in another tab, then make changes to your choices in the landing page, you'll see the updated storage information outputted as the storageevent is fired.
Window.requestAnimationFrame() - Web APIs
the window.requestanimationframe() method tells the browser that you wish to perform an animation and requests that the browser calls a specified function to update an animation before the next repaint.
... you should call this method whenever you're ready to update your animation onscreen.
... syntax window.requestanimationframe(callback); parameters callback the function to call when it's time to update your animation for the next repaint.
XRRenderState.baseLayer - Web APIs
this property is read-only; however, you can indirectly change its value using xrsession.updaterenderstate.
... see the examples below to see how to use updaterenderstate() to set the current xrwebgllayer used for rendering the scene.
... examples you can set the xrwebgllayer used for rendering by calling updaterenderstate(), like this: let canvas = document.queryselector("canvas"); gl = canvas.getcontext("webgl", { xrcompatible: true }); setnewwebgllayer(); function setnewwebgllayer(gl) { if (!gl) { /* webgl not available */ return; } xrsession.updaterenderstate({ baselayer: new xrwebgllayer(xrsession, gl); }); }; here, the canvas obtained in the first line is the canvas into which webgl is going to draw.
XRSession.requestAnimationFrame() - Web APIs
the callback takes two parameters as inputs: an xrframe describing the state of all tracked objects for the session, and a time stamp you can use to compute any animation updates needed.
... syntax requestid = xrsession.requestanimationframe(animationframecallback); parameters animationframecallback a function which is called before the next repaint in order to allow you to update and render the xr scene based on elapsed time, animation, user input changes, and so forth.
... the callback receives as input two parameters: time a domhighrestimestamp indicating the time offset at which the updated viewer state was received from the webxr device.
XRView.eye - Web APIs
WebAPIXRVieweye
gllayer = xrsession.renderstate.baselayer; gl.bindframebuffer(gl.framebuffer, gllayer.framebuffer); gl.clearcolor(0,0, 0, 1.0); gl.cleardepth(1.0); gl.clear(gl.color_buffer_bit, gl.depth_buffer_bit); for (let view of xrpose.views) { let skipview = false; if (view.eye == "left" && body.lefteye.injured) || skipview = updateinjury(body.lefteye); } else if (view.eye == "right" && body.righteye.injured) { skipview = updateinjury(body.righteye); } if (!skipview) { let viewport = gllayer.getviewport(view); gl.viewport(viewport.x, viewport.y, viewport.width, viewport.height); renderscene(gl, view); } } for each of the views, the value of eye is checked and if it's either left or right, we check ...
...to see if the body.lefteye.injured or body.righteye.injured property is true; if so, we call a function updateinjury() on that eye to do things such as allow a bit of healing to occur, track the progress of a poison effect, or the like, as appropriate for the game's needs.
... updateinjury() returns true if the eye is still injured or false if the eye has been restored to health by the function,.
Using the log role - Accessibility
by default updates contain only the changes to the live region and these are announced when the user is idle.
...to have announcements made as soon as possible and where the user may be interrupted, aria-live="assertive" can be set for more aggressive updates.
... screen magnifiers may visually indicate that a log update has occurred.
Using the slider role - Accessibility
the application will programmatically update the value of aria-valuenow in response to user input.
... <label for="fader">volume</label> <input type="range" id="fader" min="1" max="100" value="50" step="1" aria-valuemin="1" aria-valuemax="100" aria-valuenow="50" oninput="outputupdate(value)"> <output for="fader" id="volume">50</output> the following code snippet allows you to return the output as it is updated by user input: function outputupdate(vol) { document.queryselector('#volume').value = vol; } example 2: text values sometimes, a slider is used to choose a value that is not, semantically, a number.
... <label id="day-label">days</label> <div class="day-slider"> <div id="day-handle" class="day-slider-handle" role="slider" aria-labelledby="day-label" aria-valuemin="1" aria-valuemax="7" aria-valuenow="2" aria-valuetext="monday"> </div> </div> the code snippet below shows a function that responds to user input and updates the aria-valuenow and aria-valuetext attributes: var daynames = ["sunday", "monday", "tuesday", "wednesday", "thursday", "friday", "saturday"]; var updateslider = function (newvalue) { var handle = document.getelementbyid("day-handle"); handle.setattribute("aria-valuenow", newvalue.tostring()); handle.setattribute("aria-valuetext", daynames[newvalue]); }; working examples: slid...
ARIA: alert role - Accessibility
the alert role can be used to tell the user an element has been dynamically updated.
... screen readers will instantly start reading out the updated content when the role is added.
... description one of the five live region roles, the alert role is used to provide the user with important, and usually time-sensitive, information, and often to tell the user an element has been dynamically updated.
ARIA: feed role - Accessibility
if the addition of articles occupies the main browser thread, make sure to set aria-busy="true" on the feed itself, and make sure to set it back to false when processing ends, or the user may not see the updates.
... aria-busy when busy, such as when articles are being added or removed from the feed, set aria-busy="true" during the update operation.
...for example, setting aria-busy to true during the update operation if needed, and then to false upon completion.
Web accessibility for seizures and physical reactions - Accessibility
a great resource is mdn's document on window.matchmedia() media update feature the more often the screen is refreshed, the more stable it appears to the human eye, and the less it "flickers".
... "this effect is noticable, and documented, up to 70 hz." "these studies would seem to indicate that you should stay away from refresh rates under 70 hz, and use a rate not divisible by 10." eric bailey, of css-tricks, found an innovative use the update feature which, used in combination with animation-duration or transition-duration, to conclude at a rate that is imperceptible to the human eye.
... @media screen and (prefers-reduced-motion: reduce), (update: slow) { * { animation-duration: 0.001ms !important; animation-iteration-count: 1 !important; /* hat tip nick/cssremedy (https://css-tricks.com/revisiting-prefers-reduced-motion-the-reduced-motion-media-query/#comment-1700170) */ transition-duration: 0.001ms !important; } } from w3.org's page on media queries 4: the update media feature is used to query the ability of the output device to modify the appearance of content once it has been rendered.
@media - CSS: Cascading Style Sheets
WebCSS@media
update how frequently the output device can modify the appearance of content added in media queries level 4.
... width width of the viewport including width of scrollbar accessibility concerns to best accommodate people who adjust a site's text size, use ems when you need a <length> for your media queries.
... adds scripting, pointer, hover, update, overflow-block, and overflow-inline media features.
At-rules - CSS: Cascading Style Sheets
WebCSSAt-rule
(at the candidate recommendation stage, but only implemented in gecko as of writing) @font-feature-values (plus @swash, @ornaments, @annotation, @stylistic, @styleset and @character-variant) — define common names in font-variant-alternates for feature activated differently in opentype.
... (at the candidate recommendation stage, but only implemented in gecko as of writing) conditional group rules much like the values of properties, each at-rule has a different syntax.
... specifications specification status comment css conditional rules module level 3 candidate recommendation initial definition compatibility standardthe definition of 'css at-rules' in that specification.
Variable fonts guide - CSS: Cascading Style Sheets
warning: in order to use variable fonts on your operating system, you need to make sure that it is up to date.
...if your operating system is not up to date, you will not be able to use variable fonts in web pages or the firefox developer tools.
...the second example uses css custom properties to set values for a font-variation-settings string, and shows how you can more easily update single variable values by overriding a single variable rather than rewriting the whole string.
<custom-ident> - CSS: Cascading Style Sheets
candidate recommendation defines which values are excluded for will-change.
... candidate recommendation uses <custom-ident> instead of a finite list of keywords.
... candidate recommendation renames <identifier> to <custom-ident>.
Video player styling basics - Developer guides
the example in action you can find the code for the updated, styled example on github, and view it live.
...the internal <span> element used as the actual progressing part of the faked progress bar has its width initially set to 0% (it is updated via javascript) and it also has its background colour set.
...'unmute' : 'mute'); } } this function is then called by the relevant event handlers: video.addeventlistener('play', function() { changebuttonstate('playpause'); }, false); video.addeventlistener('pause', function() { changebuttonstate('playpause'); }, false); stop.addeventlistener('click', function(e) { video.pause(); video.currenttime = 0; progress.value = 0; // update the play/pause button's 'data-state' which allows the correct button image to be set via css changebuttonstate('playpause'); }); mute.addeventlistener('click', function(e) { video.muted = !video.muted; changebuttonstate('mute'); }); you might have noticed that there are new handlers where the play and pause events are reacted to on the video.
Using HTML sections and outlines - Developer guides
in the context of a section, a footer might contain the sectioned content's publication date, license information, etc.
... </p> <aside> <blockquote> amazing quote from article </blockquote> </aside> <footer> <p> author info, publication date </p> </footer> </article> nesting articles and sections articles can be nested inside of sections and sections can be nested inside of articles.
... <section> <h1>getting involved</h1> <article> <header> <h2>how to become an mdn contributor</h2> <p>do you want to help protect the web?....</p> </header> <section> <h3>steps to editing an article</h3> </section> <footer> <p>author info</p> <p>publication date</p> </footer> </article> </section> section element the section element is used for a thematic grouping of content.
HTML attribute: readonly - HTML: Hypertext Markup Language
the readonly attribute is supported by text, search, url, tel, email, password, date, month, week, time, datetime-local, and number<input> types and the <textarea> form control elements.
... constraint validation if the element is readonly, then the element's value can not be updated by the user, and does not participate in constraint validation.
... example html <div class="group"> <input type="textbox" value="some value" readonly="readonly"/> <label>textbox</label> </div> <div class="group"> <input type="date" value="2020-01-01" readonly="readonly"/> <label>date</label> </div> <div class="group"> <input type="email" value="some value" readonly="readonly"/> <label>email</label> </div> <div class="group"> <input type="password" value="some value" readonly="readonly"/> <label>password</label> </div> <div class="group"> <textarea readonly="readonly">some value</textarea> <label>message</label> </div> result examples <fieldset> <legend>checkboxes buttons</legend> <p><label> <input type="checkbox" name="chbox" value="regular"> regular </label></p> <p><label> <input type="checkbox" name="chbox" va...
<audio>: The Embed Audio element - HTML: Hypertext Markup Language
WebHTMLElementaudio
the getstartdate() method can be used to determine the beginning point of the media timeline's reference frame.
... durationchange the duration attribute has been updated.
... timeupdate the time indicated by the currenttime attribute has been updated.
<dialog>: The Dialog element - HTML: Hypertext Markup Language
WebHTMLElementdialog
examples simple example <dialog open> <p>greetings, one and all!</p> </dialog> advanced example this example opens a pop-up dialog box that contains a form, when the "update details" button is clicked.
...ialog"> <p><label>favorite animal: <select> <option></option> <option>brine shrimp</option> <option>red panda</option> <option>spider monkey</option> </select> </label></p> <menu> <button value="cancel">cancel</button> <button id="confirmbtn" value="default">confirm</button> </menu> </form> </dialog> <menu> <button id="updatedetails">update details</button> </menu> <output aria-live="polite"></output> javascript var updatebutton = document.getelementbyid('updatedetails'); var favdialog = document.getelementbyid('favdialog'); var outputbox = document.queryselector('output'); var selectel = document.queryselector('select'); var confirmbtn = document.getelementbyid('confirmbtn'); // "update details" button opens the...
... <dialog> modally updatebutton.addeventlistener('click', function onopen() { if (typeof favdialog.showmodal === "function") { favdialog.showmodal(); } else { alert("the <dialog> api is not supported by this browser"); } }); // "favorite animal" input sets the value of the submit button selectel.addeventlistener('change', function onselect(e) { confirmbtn.value = selectel.value; }); // "confirm" button of form triggers "close" on dialog because of [method="dialog"] favdialog.addeventlistener('close', function onclose() { outputbox.value = favdialog.returnvalue + " button clicked - " + (new date()).tostring(); }); result specifications specification status comment html living standardthe definition of '<dialog>' in that specification.
<input type="button"> - HTML: Hypertext Markup Language
WebHTMLElementinputbutton
gin by creating a simple button with a click event handler that starts our machine (well, it toggles the value of the button and the text content of the following paragraph): <form> <input type="button" value="start machine"> </form> <p>the machine is stopped.</p> const button = document.queryselector('input'); const paragraph = document.queryselector('p'); button.addeventlistener('click', updatebutton); function updatebutton() { if (button.value === 'start machine') { button.value = 'stop machine'; paragraph.textcontent = 'the machine has started!'; } else { button.value = 'start machine'; paragraph.textcontent = 'the machine is stopped.'; } } the script gets a reference to the htmlinputelement object representing the <input> in the dom, saving this refence in the...
... <form> <input type="button" value="start machine" accesskey="s"> </form> <p>the machine is stopped.</p> const button = document.queryselector('input'); const paragraph = document.queryselector('p'); button.addeventlistener('click', updatebutton); function updatebutton() { if (button.value === 'start machine') { button.value = 'stop machine'; paragraph.textcontent = 'the machine has started!'; } else { button.value = 'start machine'; paragraph.textcontent = 'the machine is stopped.'; } } note: the problem with the above example of course is that the user will not know what the access key is!
...illstyle = 'rgb(0,0,0)'; ctx.fillrect(0,0,width,height); var colorpicker = document.queryselector('input[type="color"]'); var sizepicker = document.queryselector('input[type="range"]'); var output = document.queryselector('.output'); var clearbtn = document.queryselector('input[type="button"]'); // covert degrees to radians function degtorad(degrees) { return degrees * math.pi / 180; }; // update sizepicker output value sizepicker.oninput = function() { output.textcontent = sizepicker.value; } // store mouse pointer coordinates, and whether the button is pressed var curx; var cury; var pressed = false; // update mouse pointer coordinates document.onmousemove = function(e) { curx = (window.event) ?
<input type="submit"> - HTML: Hypertext Markup Language
WebHTMLElementinputsubmit
formnovalidate a boolean which, if present, means the form's fields will not be subjected to constraint validation before submitting the data to the server formtarget the browsing context into which to load the response returned by the server after submitting the form formaction a string indicating the url to which to submit the data.
... formnovalidate a boolean attribute which, if present, specifies that the form should not be validated before submission to the server.
... this overrides the value of the novalidate attribute on the element's owning form.
<input type="text"> - HTML: Hypertext Markup Language
WebHTMLElementinputtext
you should use them anywhere you want the user to enter a single-line value and there isn't a more specific input type available for collecting that value (for example, if it's a date, url, email, or search term, you've got better options available).
...if your server-side code fails to validate the data it receives, disaster could strike when improperly-formatted data (or data which is too large, is of the wrong type, and so forth) is entered into your database.
... specifying a pattern you can use the pattern attribute to specify a regular expression that the inputted value must match in order to be considered valid (see validating against a regular expression for a simple crash course on using regular expressions to validate inputs).
itemscope - HTML: Hypertext Markup Language
<div itemscope itemtype="http://schema.org/recipe"> <h2 itemprop="name">grandma's holiday apple pie</h2> <img itemprop="image" src="https://udn.realityripple.com/samples/60/d063c361c1.jpg" width="50" height="50" /> <p> by <span itemprop="author" itemscope itemtype="http://schema.org/person"> <span itemprop="name">carol smith</span> </span> </p> <p> published: <time datetime="2009-11-05" itemprop="datepublished">november 5, 2009</time> </p> <span itemprop="description">this is my grandmother's apple pie recipe.
... i like to add a dash of nutmeg.</span> <br> <span itemprop="aggregaterating" itemscope itemtype="http://schema.org/aggregaterating"> <span itemprop="ratingvalue">4.0</span> stars based on <span itemprop="reviewcount">35</span> reviews </span> <br> prep time: <time datetime="pt30m" itemprop="preptime">30 min</time><br> cook time: <time datetime="pt1h" itemprop="cooktime">1 hou</time>r<br> total time: <time datetime="pt1h30m" itemprop="totaltime">1 hour 30 min</time><br> yield: <span itemprop="recipeyield">1 9" pie (8 servings)</span><br> <span itemprop="nutrition" itemscope itemtype="http://schema.org/nutritioninformation"> serving size: <span itemprop="servingsize">1 medium slice</span><br> calories per serving: <span itemprop="calories">250 cal</span><br> fa...
... structured data itemscope itemtype recipe itemprop name grandma's holiday apple pie itemprop image https://c1.staticflickr.com/1/30/42759561_8631e2f905_n.jpg itemprop datepublished 2009-11-05 itemprop description this is my grandmother's apple pie recipe.
itemtype - HTML: Hypertext Markup Language
for example, musicevent indicates a concert performance, with startdate and location properties specifying the concert's key details.
... in this case, musicevent would be the url used by itemtype, with startdate and location as itemprop's which musicevent defines.
...ng"> rating: <span itemprop="ratingvalue">4.4</span> stars, based on <span itemprop="reviewcount">89 </span> reviews </span><p> <span itemprop="offers" itemscope itemtype="http://schema.org/offer"> regular price: $179.99<br> <meta itemprop="pricecurrency" content="usd" /> <span itemprop="price">sale price: $119.99<br></span> (sale ends <time itemprop="pricevaliduntil" datetime="2020-11-05"> 5 november!</time>)<br> available from: <span itemprop="seller" itemscope itemtype="http://schema.org/organization"> <span itemprop="name">executive objects<br></span> </span> condition: <link itemprop="itemcondition" href="http://schema.org/usedcondition"/>previously owned, in excellent condition<br> <link itempr...
Using HTTP cookies - HTTP
WebHTTPCookies
an expiration date or duration can be specified, after which the cookie is no longer sent.
... permanent cookies are deleted at a date specified by the expires attribute, or after a period of time specified by the max-age attribute.
... for example: set-cookie: id=a3fwa; expires=wed, 31 oct 2021 07:28:00 gmt; note: when an expires date is set, the time and date set is relative to the client the cookie is being set on, not the server.
Expires - HTTP
WebHTTPHeadersExpires
the expires header contains the date/time after which the response is considered stale.
... invalid dates, like the value 0, represent a date in the past and mean that the resource is already expired.
... header type response header forbidden header name no cors-safelisted response header yes syntax expires: <http-date> directives <http-date> an http-date timestamp.
If-Unmodified-Since - HTTP
the if-unmodified-since request http header makes the request conditional: the server will send back the requested resource, or accept it in the case of a post or another non-safe method, only if it has not been last modified after the given date.
... if the resource has been modified after the given date, the response will be a 412 (precondition failed) error.
...http dates are always expressed in gmt, never in local time.
An overview of HTTP - HTTP
WebHTTPOverview
http can also be used to fetch parts of documents to update web pages on demand.
...scripts executed by the browser can fetch more resources in later phases and the browser updates the web page accordingly.
...for example: get / http/1.1 host: developer.mozilla.org accept-language: fr read the response sent by the server, such as: http/1.1 200 ok date: sat, 09 oct 2010 14:28:02 gmt server: apache last-modified: tue, 01 dec 2009 20:18:22 gmt etag: "51142bc1-7449-479b075b2891b" accept-ranges: bytes content-length: 29769 content-type: text/html <!doctype html...
Redirections in HTTP - HTTP
they imply that the original url should no longer be used, and replaced with the new one.search engine robots, rss readers, and other crawlers will update the original url for the resource.
... 304 not modified sent for revalidated conditional requests.
...even if you update your site's links to match the new urls, you have no control over the urls used by external resources.
A typical HTTP session - HTTP
WebHTTPSession
example responses successful web page response: http/1.1 200 ok content-type: text/html; charset=utf-8 content-length: 55743 connection: keep-alive cache-control: s-maxage=300, public, max-age=0 content-language: en-us date: thu, 06 dec 2018 17:37:18 gmt etag: "2e77ad1dc6ab0b53a2996dfd4653c1c3" server: meinheld/0.6.1 strict-transport-security: max-age=63072000 x-content-type-options: nosniff x-frame-options: deny x-xss-protection: 1; mode=block vary: accept-encoding,cookie age: 7 <!doctype html> <html lang="en"> <head> <meta charset="utf-8"> <title>a simple webpage</title> </head> <body> <h1>simple html5 web...
...page</h1> <p>hello, world!</p> </body> </html> notification that the requested resource has permanently moved: http/1.1 301 moved permanently server: apache/2.4.37 (red hat) content-type: text/html; charset=utf-8 date: thu, 06 dec 2018 17:33:08 gmt location: https://developer.mozilla.org/ (this is the new link to the resource; it is expected that the user-agent will fetch it) keep-alive: timeout=15, max=98 accept-ranges: bytes via: moz-cache-zlb05 connection: keep-alive content-length: 325 (the content contains a default page to display if the user-agent is not able to follow the link) <!doctype html...
... (contains a site-customized page helping the user to find the missing resource) notification that the requested resource doesn't exist: http/1.1 404 not found content-type: text/html; charset=utf-8 content-length: 38217 connection: keep-alive cache-control: no-cache, no-store, must-revalidate, max-age=0 content-language: en-us date: thu, 06 dec 2018 17:35:13 gmt expires: thu, 06 dec 2018 17:35:13 gmt server: meinheld/0.6.1 strict-transport-security: max-age=63072000 x-content-type-options: nosniff x-frame-options: deny x-xss-protection: 1; mode=block vary: accept-encoding,cookie x-cache: error from cloudfront <!doctype html...
HTTP response status codes - HTTP
WebHTTPStatus
you can find an updated specification in rfc 7231.
...the user-agent may update its cached headers for this resource with the new ones.
...this response is intended to prevent the 'lost update' problem, where a client gets a resource's state, modifies it, and puts it back to the server, when meanwhile a third party has modified the state on the server, leading to a conflict.
A re-introduction to JavaScript (JS tutorial) - JavaScript
the standard received a significant update as ecmascript edition 3 in 1999, and it has stayed pretty much stable ever since.
...and date and regexp, which are objects that you get for free.
...so the type diagram looks more like this: number string boolean symbol (new in es2015) object function array date regexp null undefined and there are some built-in error types as well.
JavaScript data types and data structures - JavaScript
special non-data but structural type for any constructed object instance also used as data structures: new object, new array, new map, new set, new weakmap, new set, new date and almost everything made with new keyword; function : a non-data structure, though it also answers for typeof operator: typeof instance === "function".
... dates when representing dates, the best choice is to use the built-in date utility in javascript.
...this makes arrays a perfect candidate to represent lists or sets.
Regular expressions - JavaScript
if you use exec() or match() and if the match succeeds, these methods return an array and update properties of the associated regular expression object and also of the predefined regular expression object, regexp.
... (see different behaviors for further info about the different behaviors.) if you want to construct the regular expression from a string, yet another alternative is this script: var myre = new regexp('d(b+)d', 'g'); var myarray = myre.exec('cdbbdbsbz'); with these scripts, the match succeeds and returns the array and updates the properties shown in the following table.
...updated at the time that the regular expression is created, not executed.
Reflect - JavaScript
returns a boolean that is true if the update was successful.
...returns a boolean that is true if the update was successful.
...returns a boolean that is true if the update was successful.
Standard built-in objects - JavaScript
error aggregateerror evalerror internalerror rangeerror referenceerror syntaxerror typeerror urierror numbers and dates these are the base objects representing numbers, dates, and mathematical calculations.
... number bigint math date text processing these objects represent strings and support manipulating them.
... intl intl.collator intl.datetimeformat intl.listformat intl.numberformat intl.pluralrules intl.relativetimeformat intl.locale webassembly webassembly webassembly.module webassembly.instance webassembly.memory webassembly.table webassembly.compileerror webassembly.linkerror webassembly.runtimeerror other arguments ...
instanceof - JavaScript
examples demonstrating that string and date are of type object and exceptional cases the following code uses instanceof to demonstrate that string and date objects are also of type object (they are derived from object).
... let simplestr = 'this is a simple string' let mystring = new string() let newstr = new string('string created with constructor') let mydate = new date() let myobj = {} let mynonobj = object.create(null) simplestr instanceof string // returns false, string literal is not an object mystring instanceof string // returns true newstr instanceof string // returns true mystring instanceof object // returns true myobj instanceof object // returns true, every object literal has object.prototype as prototype ({}) instanceof object // returns true, same case as above mynonobj instanceof object // returns false, prototy...
...pe is end of prototype chain (null) mystring instanceof date // returns false mydate instanceof date // returns true mydate instanceof object // returns true mydate instanceof string // returns false demonstrating that mycar is of type car and type object the following code creates an object type car and an instance of that object type, mycar.
MathML documentation index - MathML
WebMathMLIndex
3 examples beginner, example, guide, mathml, needsbeginnerupdate below you'll find some examples you can look at to help you to understand how to use mathml to display increasingly complex mathematical concepts in web content.
... 4 mathml: deriving the quadratic formula beginner, education, example, guide, html5, mathml, needsbeginnerupdate this page outlines the derivation of the quadratic formula.
... 5 proving the pythagorean theorem beginner, example, guide, html5 math, math education, mathml, needsbeginnerupdate we will now prove the pythagorean theorem: 6 mathml attribute reference mathml, mathml reference this is an alphabetical list of mathml attributes.
Web audio codec guide - Web media technologies
g.722 is primarily used with webrtc connections, as it's one of the audio codecs mandated by the webrtc specification.
... for general music playback, the three most likely candidates are mp3, aac, and vorbis.
... assuming that lossless compression is our best option here (which it usually is, as long as the audio files are small), the three strongest candidates from a codec perspective are flac, apple lossless (alac), and mpeg-4 als.
Critical rendering path - Web Performance
any time the render tree is modified, such as by added nodes, altered content, or updated box model styles on a node, layout occurs.
... to reduce the frequency and duration of layout events, batch updates and avoid animating box model properties.
...paint time depends on what kind of updates are being applied to the render tree.
Introduction to progressive web apps - Progressive web apps (PWAs)
the ability to update only the content that has changed when an app update is available.
... re-engageability one major advantage of native platforms is the ease with which users can be re-engaged by updates and new content, even when they aren't looking at the app or using their devices.
... modern web apps can now do this too, using new technologies such as service workers for controlling pages, the web push api for sending updates straight from server to app via a service worker, and the notifications api for generating system notifications to help engage users when they're not actively using their web browser.
height - SVG: Scalable Vector Graphics
WebSVGAttributeheight
candidate recommendation definition for <mask> scalable vector graphics (svg) 2the definition of 'height' in that specification.
... candidate recommendation definition as a geometry property scalable vector graphics (svg) 2the definition of 'height' in that specification.
... candidate recommendation definition for <pattern> scalable vector graphics (svg) 1.1 (second edition)the definition of 'height' in that specification.
width - SVG: Scalable Vector Graphics
WebSVGAttributewidth
candidate recommendation definition for <mask> scalable vector graphics (svg) 2the definition of 'width' in that specification.
... candidate recommendation definition as a geometry property scalable vector graphics (svg) 2the definition of 'width' in that specification.
... candidate recommendation definition for <pattern> scalable vector graphics (svg) 1.1 (second edition)the definition of 'width' in that specification.
Certificate Transparency - Web security
with the latter methods, servers will need to be updated to send the required data.
... browser requirements google chrome requires ct log inclusion for all certificates issues with a notbefore date of after 30 april 2018.
...in chrome, even if the certificate was issued with a notbefore date prior to april).
panel - Archive of obsolete content
": "./icon-32.png", "64": "./icon-64.png" }, onchange: handlechange }); var mypanel = sdkpanels.panel({ contenturl: self.data.url("panel.html"), onhide: handlehide }); function handlechange(state) { if (state.checked) { mypanel.show({ position: button }); } } function handlehide() { button.state('window', {checked: false}); } updating panel content you can update the panel's content by: sending a message to a content script that updates the dom in the same document.
...setting it updates the panel's content immediately.
ui/frame - Archive of obsolete content
you can specify the frame's url property as the targetorigin: frame.postmessage(message, frame.url); this add-on listens for a frame script to send the "city changed" message above, and in response, updates all frames across all browser windows with that city's current weather (it just reads this from a dictionary, where in a real case it might ask a web service): var { frame } = require("sdk/ui/frame"); var { toolbar } = require("sdk/ui/toolbar"); var weather = { "london" : "rainy", "toronto" : "snowy", "san francisco" : "foggy" } var frame = new frame({ url: "./city-info.html", onmes...
...sage: (e) => { updateweather(e.data); } }); var toolbar = toolbar({ name: "city-info", title: "city info", items: [frame] }); function updateweather(location) { frame.postmessage(weather[location], frame.url); } to listen to these messages in the frame script, add a listener to the window's message event: window.addeventlistener("message", updateweather, false); function updateweather(message) { var label = window.document.getelementbyid("weather"); label.textcontent = message.data; } from add-on to a specific frame you can send a message from the main add-on code to the frame hosted by a particular browser window.
cfx to jpm - Archive of obsolete content
to get new updates of cfx you download and extract a new zip file, while to get the new version of jpm, use npm update.
...for example: addons.mozilla.org uses it to distinguish between new add-ons and updates to existing add-ons, and the simple-storage module uses it to figure out which stored data belongs to which add-on.
Creating annotations - Archive of obsolete content
its main job is to maintain a matched element: this is the page element that is the current candidate for an annotation.
... updating main.js again now we'll update main.js again to create the editor and use it.
Bookmarks - Archive of obsolete content
you can use the nsinavbookmarksservice.changebookmarkuri() method to update the uri for a given bookmark item: var uri = ios.newuri("http://mozilla.com/", null, null); bmsvc.changebookmarkuri(newbkmkid, uri); this example changes the bookmark to refer to the mozilla web site instead of google.
... // an nsinavbookmarkobserver var myext_bookmarklistener = { onbeginupdatebatch: function() {}, onendupdatebatch: function() {}, onitemadded: function(aitemid, afolder, aindex) {}, onitemremoved: function(aitemid, afolder, aindex) {}, onitemchanged: function(abookmarkid, aproperty, aisannotationproperty, avalue) { myextension.dosomething(); }, onitemvisited: function(abookmarkid, avisitid, time) {}, onitemmoved: function(aitemid, aoldparent, aoldindex,...
JavaScript timers - Archive of obsolete content
setimmediate() calls a function immediately after the browser has completed other operations, such as events and display updates.
... date.now() date.now() returns the number of milliseconds elapsed since 1 january 1970 00:00:00 utc.
Listening to events in Firefox extensions - Archive of obsolete content
pageshoweventhandlers the pageshoweventhandlers() function is called by the pageshow event and is used to populate the character set menu and update the ui elements associated with any detected feeds or opensearch plugins for the website.
...it is used to update the ui for many different reasons: update the progress bar and status messages as pages load turn on and off the throbber as pages load set the site icon when available update the address bar as the user navigates hide notification bars when appropriate as the user navigates apply the site zoom preferences to newly loading pages update the bookmarking star button ui update the identity display as the site's security changes tabsprogresslistener this object is a tabs progress listener and receives events for all browsers in the window.
Appendix B: Install and Uninstall Scripts - Archive of obsolete content
it is also common for an add-on to require to run a script only when it is installed for the first time, or every time it is updated.
... if you need to run code on every update, or some of them, the code would be very similar.
Appendix C: Avoiding using eval in Add-ons - Archive of obsolete content
add-on authors are strongly encouraged to update their code to eliminate all instances of eval, no matter if the add-on is to be hosted in the mozilla add-ons gallery or not.
...of course, you'll need to update your add-on if the application changes.
Introduction - Archive of obsolete content
this tutorial was written after firefox 3 was released, and has been updated with time.
... while most of it should still work for creating extensions in firefox 3 (and even firefox 2), it is strongly recommended that you aim to support modern firefox versions, to encourage users to stay up to date with security fixes.
Creating a status bar extension - Archive of obsolete content
you can find a more up-to-date tutorial in the xul school tutorial the essentials of an extension.
... homepageurl the url of a web site the user can visit to get information about the extension, or to look for updates.
checking - Archive of obsolete content
the checking event is fired when the user agent is checking for an update, or attempting to download the cache manifest for the first time.
... related events checking noupdate downloading progress cached updateready obsolete error ...
downloading - Archive of obsolete content
the downloading event is fired after checking for an application cache update, if the user agent has found an update and is fetching it, or is downloading the resources listed by the cache manifest for the first time.
... related events checking noupdate progress cached updateready obsolete error ...
Monitoring WiFi access points - Archive of obsolete content
the onchange() method (lines 13 through 27) begins by enabling universalxpconnect privileges, then clearing out the div (d) that will receive the updated list of access points.
...then the c div is updated with the number of times the list has been refreshed.
Notes on HTML Reflow - Archive of obsolete content
dirty, when a container frame has consolidated several individual incremental reflows that have been targeted at its child frames.
... original document information author(s): chris waterson last updated date: december 4, 2004 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Bookmark Keywords - Archive of obsolete content
any web site that you commonly search is a candidate for its own keymark.
...meyer, netscape communications last updated date: published 15 mar 2002 copyright information: copyright © 2001-2003 netscape.
Building TransforMiiX standalone - Archive of obsolete content
this document is out of date.
... original document information author: axel hecht last updated date: april 5, 2004 copyright information: portions of this content are © 1998–2006 by individual mozilla.org contributors; content available under a creative commons license ...
Enabling the behavior - updating the status bar panel - Archive of obsolete content
in order for loadtinderboxstatus() to have any effect we need to define a matching updatetinderboxstatus() function.
... function updatetinderboxstatus() { var icon = document.getelementbyid('tinderbox-status'); if (gxmlhttprequest.responsetext.match("ee0000")) icon.setattribute("status", "busted"); else if (gxmlhttprequest.responsetext.match("ffaa00")) icon.setattribute("status", "testfailed"); else if (gxmlhttprequest.responsetext.match("11dd11")) icon.setattribute("status", "success"); else icon.setattribute("status", ""); } updatetinderboxstatus() retrieves a reference to the statusbarpanel element then searches through the retrieved html document (stored in the responsetext property of the xmlhttprequest instance) for one of several color references.
Making it into a dynamic overlay and packaging it up for distribution - Archive of obsolete content
warning: the content of this article may be out of date.
...see building an extension for updated instructions.
Getting Started - Archive of obsolete content
skin\classic\mozapps mozapps contains all the styles and icons for the browser peripherals, such as the extension manager or update wizard.
...you will also have to update the minimum and maximum compatible versions for the target application (seamonkey) in the following section: <em:targetapplication> <description> <!-- seamonkey's uuid --> <em:id>{92650c4d-4b8e-4d2a-b7eb-24ecf4f6b63a}</em:id> <em:minversion>min_sm_version</em:minversion> <em:maxversion>max_sm_version</em:maxversion> </description> </em:targetapplication> estab...
Creating a Skin for Firefox/Getting Started - Archive of obsolete content
skin\classic\mozapps mozapps contains all the styles and icons for the browser peripherals, such as the extension manager or update wizard.
... you will also have to update the minimum and maximum compatible versions for the target application (firefox) in the following section: <em:targetapplication> <description> <!-- firefox's uuid --> <em:id>{ec8030f7-c20a-464f-9b0e-13a3a9e97384}</em:id> <em:minversion>min_ff_version</em:minversion> <em:maxversion>max_ff_version</em:maxversion> </description> </em:targetapplication> establi...
Editor Embedding Guide - Archive of obsolete content
(similar to "text" but html can be inserted; intended for plaintext mail usage and handling of citations) "html" (this is the default type if no type is specified; it allows for all html tags to be inserted) "htmlmail" (this is much like "html" except there are a few editing rules/behaviors that differ such as splitting of mail quotes) editor commands you need to call commands and receive updates in order to make any changes to the content on the browser.
... commandparam->getbooleanvalue("state_enabled",&boolval); original document information authors: michael judge (mjudge@netscape.com) contributor: kathleen brade (brade@netscape.com) last updated date: march 27, 2003 original document: a guide to embedding the gecko editor ...
External CVS snapshots in mozilla-central - Archive of obsolete content
such changes will get overwritten without warning on importing the next updated version.
... nspr nsprpub nss dbm security/dbm security/coreconf security/nss special procedures must be used to update these to newer snapshots of the upstream software projects.
Hidden prefs - Archive of obsolete content
warning: the content of this article may be out of date.
... it was imported from mozilla.org and last updated in 2002.
Java in Firefox Extensions - Archive of obsolete content
note: the global java object has been removed in gecko 16.0, so this page is out of date.
...the following approach is taken from the extension xquseme (note you must use the latest version, currently still in the sandbox, as prior versions only worked with liveconnect before java 6 update 11) which borrows some of the code of the java firefox extension in order to grant full privileges to java within a firefox extension, but it is easier to understand and doesn't require creation of a xpcom component.
Mozilla Application Framework - Archive of obsolete content
lxr a web interface to the mozilla codebase that shows you every file in the repository as well as a line-by-line breakdown of who changed which line when in each file bonsai a web interface to the checkin log that you can query for checkins between certain dates, of certain files, or by certain developers.
... original document information author(s): myk melez last updated date: march 3, 2003 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Plug-n-Hack Get Involved - Archive of obsolete content
while this project has been started by the mozilla security team and has been validated with firefox and owasp zap, this is an open project and we welcome involvement from anyone, especially people working on other browsers and security tools.
...to contribute or keep up to date with plug-n-hack changes please joion the mozilla plug-n-hack google group.
Priority Content - Archive of obsolete content
update: i've removed documents from this list that have been migrated into the wiki.
... original: rich-text editing in mozilla 1.3 wiki location: rich-text editing in mozilla i dropped the 1.3, as the article still applies and shouldn't sound outdated.
Hacking wiki - Archive of obsolete content
to configure it, run <tt>update-devmo.php</tt> from the command line.
... the following worked for me (from the <tt>www</tt> directory): /path/to/php -f ./maintenance/update-devmo.php done you should have a working install of the mdc wiki now.
Frequently Asked Questions - Archive of obsolete content
note: this page is extremely out of date.
... original document information author(s): jonathan watt last updated date: november 6, 2006 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Space Manager Detailed Design - Archive of obsolete content
if the collection is too small, then an error is returned and the count is updated to indicate the size required.
... cross-component algorithms tech notes original document information author(s): marc attinasi other contributors: david baron, josh soref last updated date: november 25, 2005 ...
Table Cellmap - Archive of obsolete content
the current solution is to use nscellmap::getdataat with a special argument aupdatezerospan to repair the cellmap if it encounters a empty cell (nsnull), by looking for a origin of a zero row- or colspan that spans the queried place in the cellmap.
... original document information author(s): bernd mielke last updated date: september 27, 2003 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
The new nsString class implementation (1999) - Archive of obsolete content
the i18n team correctly points out that that anarchy will prevail if judicious control over their use is not mandated.
... original document information author: rick gessner last updated date: january 20, 1999 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Using addresses of stack variables with NSPR threads on win16 - Archive of obsolete content
it's difficult to tell exaclty where the updated <tt>counter</tt> is being stored.
... original document information author: larryh@netscape.com, wan teh chang last updated date: december 1, 2004 this note is about writing win16-portable code that uses nspr threads, probably not interesting to today's developers ...
Elements - Archive of obsolete content
note: prior to firefox 3, the constructor could be called at a time when reflow of the document layout was locked down, so that attempting to get layout information from within the constructor could return out of date information.
... in firefox 3 and later, the constructor is called when reflow can take place, which results in up-to-date information being returned.
XBL 1.0 Reference - Archive of obsolete content
ints <children> handling dom changes event flow and targeting flow and targeting across scopes focus and blur events mouseover and mouseout events anonymous content and css selectors and scopes binding stylesheets binding implementations introduction methods properties inheritance of implementations event handlers example - sticky notes updated and adjusted for the current firefox implementation.
... notes.html notes.xml notes.css view this example download all files (.zip archive) need to ask to adjust the server - it gives "access denied" for zip files (?) references initial xbl 1.0 proposal submitted as a note to w3c (does not reflect mozilla implementation, nor future plans) xbl 2.0 project original document information last updated date: april 24, 2006 ...
XBL - Archive of obsolete content
hopefully, the reference will be updated to describe those differences.
... xbl 2.0 (w3c candidate recommendation) was developed to address problems found in xbl 1.0 and to allow for implementations in a broader range of web browsers.
Install Wizards (aka: Stub Installers) - Archive of obsolete content
warning: the content of this article may be out of date.
... original document information author(s): samir gehani other contributors: curt patrick last updated date: march 12, 2003 copyright information: copyright (c) samir gehani, curt patrick ...
Windows Install - Archive of obsolete content
rpath); // convert the available disk space into kilobytes spaceavailable = parseint(spaceavailable / 1024); // do the verification if(spaceavailable < spacerequired) { logcomment("insufficient disk space: " + dirpath); logcomment(" required : " + spacerequired + " k"); logcomment(" available: " + spaceavailable + " k"); return(false); } return(true); } function updatewinreg4ren8dot3() { var fprogram = getfolder("program"); var ftemp = getfolder("temporary"); //notes: // can't use a double backslash before subkey // - windows already puts it in.
...ot3ini != null) { for(i = 0; i < listlongfilepaths.length; i++) { flongfilepath = getfolder(fprogram, listlongfilepaths[i]); sshortfilepath = file.windowsgetshortname(flongfilepath); if(sshortfilepath) { fren8dot3ini.writestring("rename", sshortfilepath, flongfilepath); binicreated = true; } } if(binicreated) updatewinreg4ren8dot3() ; } return(0); } // main var srdest; var err; var fprogram; srdest = 449; err = initinstall(prettyname, regname, "6.0.0.2000110801"); logcomment("initinstall: " + err); fprogram = getfolder("program"); logcomment("fprogram: " + fprogram); if(verifydiskspace(fprogram, srdest)) { setpackagefolder(fprogram); err = adddirectory("", "6.0.0.2000110801", "bin", // di...
Methods - Archive of obsolete content
moddate returns a number representing the last modified date of the given file.
... moddatechanged specifies whether the last modification on a file is older than a specified date move moves a file from one location to another.
addDirectory - Archive of obsolete content
name, string xpisourcepath, object localdirspec, string relativelocalpath); public int adddirectory ( string registryname, string version, string xpisourcepath, object localdirspec, string relativelocalpath); public int adddirectory ( string registryname, string version, string xpisourcepath, object localdirspec, string relativelocalpath, boolean forceupdate); public int adddirectory ( string registryname, installversion version, string xpisourcepath, object localdirspec, string relativelocalpath, boolean forceupdate); parameters the adddirectory method has the following parameters: registryname the pathname in the client version registry for the root directory of the files that are to be installed.this parameter ca...
... xpisourcepath a string specifying the location of the directory within the xpi file.an empty string ("") causes the creation of a subdirectory node in the registry without actually unpacking any files, which may be useful when you are updating a package that contains subcomponents that could also be updated separately.
patch - Archive of obsolete content
summary updates an existing component.
... description the patch method to update an existing component by applying a set of differences between two known versions.
XPInstall API reference - Archive of obsolete content
file getwinregistry initinstall loadresources logcomment patch performinstall refreshplugins registerchrome reseterror setpackagefolder installtrigger no properties methods compareversion enabled getversion install installchrome startsoftwareupdate installversion properties methods compareto init tostring file no properties methods copy dircreate dirgetparent dirremove dirrename diskspaceavailable execute exists isdirectory isfile macalias moddate moddatechanged ...
... setrootkey setvalue setvaluenumber setvaluestring valueexists winregvalue constructor other information return codes see complete list examples trigger scripts and install scripts code samples file.macalias file.windowsshortcut install.adddirectory install.addfile installtrigger.installchrome installtrigger.startsoftwareupdate windows install ...
A XUL Bestiary - Archive of obsolete content
the w3c has standardized on a particular dom and already has a candidate recommendation for an updated version.
...these three cross-platform glue technologies fit in the middle of an architecture that looks something like this: author: ian oeschger other documents: mozilla jargon file and introduction to xul original document information author(s): ian oeschger last updated date: april 16, 2000 copyright information: copyright (c) ian oeschger ...
disableautoselect - Archive of obsolete content
« xul reference home disableautoselect type: boolean if this attribute is true or omitted, the selected item on the menu will update to match what the user entered in the textbox.
...if this attribute is false, the selection is never updated to match the text box.
events - Archive of obsolete content
« xul reference home events type: comma-separated list a comma-separated list of event names that the command updater will update upon.
...you can send a custom event by calling the updatecommands method of the command dispatcher.
sizemode - Archive of obsolete content
note: when a window is minimized, the sizemode attribute is not updated.
... issues with this attribute (at least on firefox 3): sizemode is only updated when the value of the persist attribute on the root element (such as <window>) contains sizemode.
targets - Archive of obsolete content
« xul reference home targets type: comma-separated list of element ids a comma-separated list of element ids that the command updater will update upon.
...the command update will only occur when the event occurs to one of the specified elements.
Building accessible custom components in XUL - Archive of obsolete content
axspreadsheet" flex="1"> <rows flex="1"></rows> <columns flex="1"> <column> <description value="entry #"/> <description value="1"/> <description value="2"/> <description value="3"/> <description value="4"/> <description value="5"/> <description value="6"/> <description value="7"/> </column> <column flex="1"> <description value="date"/> <label value="03/14/05" flex="1"/> <label value="03/15/05" flex="1"/> <label value="03/15/05" flex="1"/> <label value="03/16/05" flex="1"/> <label value="03/16/05" flex="1"/> <label value="03/16/05" flex="1"/> <label value="03/16/05" flex="1"/> </column> <column flex="1"> <description value="expense"/> <label value="conference fee" ...
...value="2"/> <description x2:role="wairole:rowheader" value="3"/> <description x2:role="wairole:rowheader" value="4"/> <description x2:role="wairole:rowheader" value="5"/> <description x2:role="wairole:rowheader" value="6"/> <description x2:role="wairole:rowheader" value="7"/> </column> <column flex="1"> <description x2:role="wairole:columnheader" value="date"/> <label x2:role="wairole:gridcell" value="03/14/05" flex="1"/> <label x2:role="wairole:gridcell" value="03/15/05" flex="1"/> <label x2:role="wairole:gridcell" value="03/15/05" flex="1"/> <label x2:role="wairole:gridcell" value="03/16/05" flex="1"/> <label x2:role="wairole:gridcell" value="03/16/05" flex="1"/> <label x2:role="wairole:gridcell" value="03/16/05"...
Deprecated and defunct markup - Archive of obsolete content
even some of the information on the tags below may be out of date, but is provided here for historical reference and to help anyone who comes across them in old code or documentation.
...nal name for the ancestor <treechildren> element --neil 03 march 2011 <treecaption> (old/experimental and unsupported xul tags) <treecolgroup> (former name for <treecols> <treecolpicker> (internal use only; part of xbl for <tree>) <treefoot> (old/experimental and unsupported xul tags) <treeindentation> (old/experimental and unsupported xul tags) was a part of the old <tree> that predated <outliner> that was not converted to <listbox>--neil 03 march 2011 <treeicon> (old/experimental and unsupported xul tags) <treerows> (internal use only; part of xbl for <tree>) attributes @debug="true" provided struts and springs around boxes to facilitate identification of flex issues but does not seem to work now you need a special debug_layout build --neil 03 march 2011 referen...
Getting File Information - Archive of obsolete content
it is convenient to pass the returned time to the date constructor.
... var lastmod = new date(file.lastmodifiedtime); in this example, a date object is created using the modification time of a file.
insertItemAt - Archive of obsolete content
note: you cannot insert an item to an index that does not exist, eg: trying to insert an item at the end with element.getrowcount() + 1 example <!-- this example inserts at the selected item or appends, then selects the newly created item --> <script language="javascript"> function insertitemtolist(){ var mylistbox = document.getelementbyid('mylistbox'); // create a date to get some labels and values var somedate = new date(); if(mylistbox.selectedindex == -1){ // no item was selected in list so append to the end mylistbox.appenditem( somedate.tolocaletimestring(), somedate.gettime() ); var newindex = mylistbox.getrowcount() -1 }else{ // item was selected so insert at the selected item var newindex = mylistbo...
...x.selectedindex; mylistbox.insertitemat(newindex, somedate.tolocaletimestring(), somedate.gettime()); } // select the newly created item mylistbox.selectedindex = newindex; } </script> <button label="insert item at selected" oncommand="insertitemtolist()"/> <listbox id="mylistbox"> <listitem label="foo"/> </listbox> see also appenditem() removeitemat() ...
PopupEvents - Archive of obsolete content
<panel id="time-panel" onpopupshowing="this.lastchild.value = (new date()).tolocaleformat('%t')"> <label value="time:"/> <label id="time"/> </panel> <toolbarbutton label="show time" popup="time-panel"/> you can prevent a menu or popup from appearing by calling the preventdefault method of the event from within a popupshowing listener.
...the popupshown event will be fired when the ui is updated and the popup is visible.
Building Trees - Archive of obsolete content
here is an example (using an rdf source): <tree id="photoslist" flex="1" datasources="template-guide-photos5.rdf" ref="http://www.xulplanet.com/rdf/myphotos" flags="dont-build-content"> <treecols> <treecol id="name" label="name" flex="1"/> <treecol id="date" label="date" flex="1"/> </treecols> <template> <treechildren> <treeitem uri="rdf:*"> <treerow> <treecell label="rdf:http://purl.org/dc/elements/1.1/title"/> <treecell label="rdf:http://purl.org/dc/elements/1.1/date"/> </treerow> </treeitem> </treechildren> </template> </tree> note: the tree columns (treecols) are declared outside ...
...here is an example of a tree using an sqlite datasource: <tree datasources="profile:messages.sqlite" ref="*" querytype="storage" flags="dont-build-content"> <treecols> <treecol id="subject" label="subject" flex="3"/> <treecol id="sender" label="sender" flex="2"/> <treecol id="date" label="date" flex="1"/> </treecols> <template> <query> select subject, sender, date from messages </query> <action> <treechildren> <treeitem uri="?"> <treerow> <treecell label="?subject"/> <treecell label="?sender"/> <treecell label="?date"/> </treerow> </treeitem> </treechildren> </acti...
textbox (Toolkit autocomplete) - Archive of obsolete content
visible controls have a disabled property which, except for menus and menuitems, is normally preferred to use of the attribute, as it may need to update additional state.
...a listener for the command event should update search results.
Textbox (XPFE autocomplete) - Archive of obsolete content
visible controls have a disabled property which, except for menus and menuitems, is normally preferred to use of the attribute, as it may need to update additional state.
...a listener for the command event should update search results.
Commands - Archive of obsolete content
you may have to click the listbox to update the menu in this simple example.
... next, we'll find out how to update commands.
Custom Tree Views - Archive of obsolete content
the following example shows this: <tree id="my-tree" flex="1"> <treecols> <treecol id="namecol" label="name" flex="1"/> <treecol id="datecol" label="date" flex="1"/> </treecols> <treechildren/> </tree> to assign data to be displayed in the tree, the view object needs to be created which is used to indicate the value of each cell, the total number of rows plus other optional information.
... getimagesrc: function(row,col){ return null; }, getrowproperties: function(row,props){}, getcellproperties: function(row,col,props){}, getcolumnproperties: function(colid,col,props){} }; function setview(){ document.getelementbyid('my-tree').view = treeview; } </script> <tree id="my-tree" flex="1"> <treecols> <treecol id="namecol" label="name" flex="1"/> <treecol id="datecol" label="date" flex="1"/> </treecols> <treechildren/> </tree> </window> in the image, you can see two columns, each with data taken from the getcelltext() function.
Focus and Selection - Archive of obsolete content
typically, you will use focus and blur events to update parts of the interface as the user selects elements.
... for instance, you might update a total as the user enters values in other fields, or use focus events to validate certain values.
Localization - Archive of obsolete content
<tabpanel id="searchpanel" orient="vertical" context="editpopup"> <description> &finddescription; </description> <spacer class="titlespace"/> <groupbox orient="horizontal"> <caption label="&findcriteria;"/> <menulist id="searchtype"> <menupopup> <menuitem label="&type.name;"/> <menuitem label="&type.size;"/> <menuitem label="&type.date;"/> </menupopup> </menulist> <spacer class="springspace"/> <menulist id="searchmode"> <menupopup> <menuitem label="&mode.is;"/> <menuitem label="&mode.isnot;"/> </menupopup> </menulist> <spacer class="springspace"/> <menulist id="find-text" flex="1" editable="true" datasources="file:///mozilla/recents.rdf" ...
...andkey "c"> <!entity pastecmd.commandkey "v"> <!entity opencmdtoolbar.label "open"> <!entity savecmdtoolbar.label "save"> <!entity searchtab "search"> <!entity optionstab "options"> <!entity finddescription "enter your search criteria below and select the find button to begin the search."> <!entity findcriteria "search criteria"> <!entity type.name "name"> <!entity type.size "size"> <!entity type.date "date modified"> <!entity mode.is "is"> <!entity mode.isnot "is not"> <!entity casesensitive "case sensitive search"> <!entity matchfilename "match entire filename"> <!entity results.filename "filename"> <!entity results.location "location"> <!entity results.size "size"> <!entity bytes.before ""> <!entity bytes.after "bytes"> <!entity button.find "find"> <!entity button.cancel "cancel"> now, to...
Modifying a XUL Interface - Archive of obsolete content
example 7 : source view <script> function updatestate(){ var name = document.getelementbyid("name"); var sindex = document.getelementbyid("group").selectedindex; name.disabled = sindex == 0; } </script> <radiogroup id="group" onselect="updatestate();"> <radio label="random name" selected="true"/> <hbox> <radio label="specify a name:"/> <textbox id="name" value="jim" disabled="true"/> </hbox> </radiogroup> in this example a...
... function updatestate() is called whenever a select event is fired on the radio group.
More Event Handlers - Archive of obsolete content
here is an example which displays the current mouse coordinates: example 4 : source view <script> function updatemousecoordinates(e){ var text = "x:" + e.clientx + " y:" + e.clienty; document.getelementbyid("xy").value = text; } </script> <label id="xy"/> <hbox width="400" height="400" onmousemove="updatemousecoordinates(event);"/> in this example, the size of the box has been set explicitly so the effect is easier to see.
...note that the event argument must be passed to the updatemousecoordinates function.
Skinning XUL Files by Hand - Archive of obsolete content
software components and users will be able to update the chrome registry and change the global skin.
... original document information author(s): ian oeschger last updated date: october 3, 2004 copyright information: copyright (c) ian oeschger ...
XPCOM Interfaces - Archive of obsolete content
a file would need properties for its name, modification date and its size.
...the component will have code which can retrieve the file's name, date and size.
Using Remote XUL - Archive of obsolete content
dding the menu bar into the pages; (we can use xbl to embed xul into html pages to get around the limitations of iframes.) integrating the search function into the menu bar so you don't have to go to a separate page to use it; hiding the html-based navigation for users who can see the xul-based navigation; storing the menu structure and items in a remote rdf datasource to make them easier to update and reuse.
... original document information last updated date: december 7, 2002 ...
Using the Editor from XUL - Archive of obsolete content
warning: the content of this article may be out of date.
... original document information author(s): editor team last updated date: july 25, 2000 copyright information: copyright (c) editor team ...
XUL Questions and Answers - Archive of obsolete content
some of them can be tied to a preference so that the preference is automatically updated as the control is manipulated.
... others, like <listbox>, cannot be so tied, but one can always write a script that updates preferences explicitly, via nsiprefbranch interface.
XUL Reference - Archive of obsolete content
« xul reference « alphabetical list of all xul elements action arrowscrollbox assign bbox binding bindings box broadcaster broadcasterset button browser checkbox caption clicktoscroll colorpicker column columns commandset command conditions content datepicker deck description dialog dialogheader dropmarker editor grid grippy groupbox hbox iframe image key keyset label listbox listcell listcol listcols listhead listheader listitem member menu menubar menuitem menulist menupopup menuseparator notification notificationbox observes overlay page panel param popupset preference preferences prefpane prefwindow progressmeter query queryset radio radiogroup resizer richlistbox richlistitem row rows rule scale scri...
...zer statusbar statusbarpanel dialogheader notification notificationbox menubar menu menuitem menuseparator menupopup panel tooltip popupset toolbar toolbarbutton toolbargrippy toolbaritem toolbarpalette toolbarseparator toolbarset toolbarspacer toolbarspring toolbox tabbox tabs tab tabpanels tabpanel groupbox caption separator spacer button checkbox colorpicker datepicker menulist progressmeter radio radiogroup scale splitter textbox textbox (firefox autocomplete) textbox (mozilla autocomplete) timepicker description label image listbox listitem listcell listcol listcols listhead listheader richlistbox richlistitem tree treecell treechildren treecol treecols treeitem treerow treeseparator box hbox vbox bbox deck stack gri...
XUL Template Primer - Bindings - Archive of obsolete content
warning: the content of this article may be out of date.
... see xul:template guide for up to date documentation.
image - Archive of obsolete content
ArchiveMozillaXULimage
attributes onerror, onload, src, validate properties accessibletype, src style classes alert-icon, error-icon, message-icon, question-icon examples <image src='firefoxlogo.png' width='135' height='130'/> attributes onerror type: script code this event is sent to an image element when an error occurs loading the image.
... validate type: one of the values below this attribute indicates whether to load the image from the cache or not.
preference - Archive of obsolete content
visible controls have a disabled property which, except for menus and menuitems, is normally preferred to use of the attribute, as it may need to update additional state.
... void updateelements(); update all elements that observe this preference.
splitter - Archive of obsolete content
this attribute will be updated automatically as the splitter is moved, and is generally used in a stylesheet to apply a different appearance for each state.
... <tree id="tree1" flex="1" height="300" enablecolumndrag="true"> <treecols> <treecol id="name" label="name" flex="1"/> <splitter class="tree-splitter"/> <treecol id="id" label="id" flex="1"/> <splitter class="tree-splitter"/> <treecol id="date" label="date" flex="1"/> <splitter class="tree-splitter"/> </treecols> <treechildren/> </tree> splitter resizing and overflow the degree to which a splitter will resize a box, and what happens during the resize and after the limit is reached, depends on the height (or width) specified for the box as an attribute or in css, the min-height (or min-width), the intrinsic height of the box ...
toolbar - Archive of obsolete content
the value is updated automatically by the toolbar customization dialog.
...be careful, as setting this property doesn't automatically update the currentset attribute.
tree - Archive of obsolete content
ArchiveMozillaXULtree
however, the content view will automatically update the tree if treeitems are changed.
... visible controls have a disabled property which, except for menus and menuitems, is normally preferred to use of the attribute, as it may need to update additional state.
CommandLine - Archive of obsolete content
for the sake of simplicity, the proposed solution involves the observer service to notify observers that the updated arguments are available.
...</window> original document information author: georges-etienne legendre last updated date: august 21st, 2007 ...
application/http-index-format specification - Archive of obsolete content
last-modified rfc 1123 date format url encoded.
...: 200: filename content-length content-type file-type last-modified 201: foo.txt 512 text/plain file tue,%2015%20nov%201994%2008:12:31%20gmt 201: bar.html 9683 text/html file tue,%2025%20oct%201994%2008:12:31%20gmt 201: foobar 0 application/http-index-format directory tue,%2025%20oct%201994%2008:12:31%20gmt original document information author(s): christian biesinger last updated date: may 10, 2004 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Mozilla.dev.apps.firefox-2006-09-29 - Archive of obsolete content
summary: mozilla.dev.apps.firefox - september 22-29, 2006 announcements bon echo 20060921 nightly to recieve "major update" offer mike beltnzer announced that 'users running the bon echo 20060921 nightly build will be offered the chance to upgrade to a "new version"' firefox start up performance boris zbarsky recently performed some profiling of firefox's start up - these are some of the details discussions problem handling dmg files on mac discussion about why sometimes dmg files are not mounted correctly after they are downloaded.
... firefox 2 on windows vista discussion about the "state of affairs" of firefox 2 on windows vista rc1 - update for rc1 listed in update history as 'install pending' right-click "copy email address" - bug 353102 a proposed bug fix to the 'copy email address' bug how to use the rss feeds discovery & parsing tool in another open source project?
2006-09-29 - Archive of obsolete content
updated l10n status for sunbird 0.3 release according to simon paquet, we now have a full l10n comparison on the trunk between en-us and all locales with a calendar localization.
...27, the meeting was cancelled and rescheduled for a later date.
2006-09-29 - Archive of obsolete content
summary: mozilla.dev.apps.firefox - september 22-29, 2006 announcements bon echo 20060921 nightly to recieve "major update" offer mike beltnzer announced that 'users running the bon echo 20060921 nightly build will be offered the chance to upgrade to a "new version"' firefox start up performance boris zbarsky recently performed some profiling of firefox's start up - these are some of the details discussions problem handling dmg files on mac discussion about why sometimes dmg files are not mounted correctly after they are downloaded.
... firefox 2 on windows vista discussion about the "state of affairs" of firefox 2 on windows vista rc1 - update for rc1 listed in update history as 'install pending' right-click "copy email address" - bug 353102 a proposed bug fix to the 'copy email address' bug how to use the rss feeds discovery & parsing tool in another open source project?
2006-11-10 - Archive of obsolete content
what is the build date for firefox 2?
... quesiton about why a user using firefox 2 rc3 didn't get a prompt for updating to firefox 2 after the release date.
2006-11-24 - Archive of obsolete content
discussions microsummary w/ script a user created patch that will allow script to run in a sandbox during the update of a microsummary.
... trunk builds + winxp update = broken?
2006-10-06 - Archive of obsolete content
a: robert helmer pointed out the mozilla.org's config file could be found here and to look for -->mozconfig<---------------------------------------- -->end mozconfig<---------------------------------------- updated: developer documentation issues for thunderbird 2 eric shepherd has requested feedback for any developer documentation issues that might need dealing with for thunderbird 2.
... updated : need ui to rearrange tags peter lairo suggested some ui should be available for rearranging tags.
2006-11-03 - Archive of obsolete content
discussions what is the 'lastmodifieddate' item used for in tb?
... there are some code example given and also further discussion on lastmodifieddate.
2006-10-27 - Archive of obsolete content
update-packaging october 27: atachi.hayash wanted to know if you use msys would update-packaging work.
... click here to view the errorthat he receives when trying to update-packaging.
2006-10-27 - Archive of obsolete content
update check failing in firefox 2.0 if add-on type is 8 testing a custom update.rdf file for a langpack using the official version of firefox 2.0 rc 3.
... alternative german locale while the alternative locale is active, the auto update of firefox stops working.
2006-10-06 - Archive of obsolete content
summary: mozilla.dev.quality - september 30-october 6, 2006 announcements firefox 2 rc2 update - the minimum tests for rc2 are complete which includes smoke and bft tests.
...update checker was run; all failures found were expected.
NPEvent - Archive of obsolete content
values: 0 nullevent 1 mousedown 2 mouseup 3 keydown 4 keyup 5 autokey 6 updateevt 7 diskevt 8 activateevt 15 osevt 23 khighlevelevent getfocusevent 0, 1 (true, false) losefocusevent adjustcursorevent 0, 1 (true, false) for information about these events, see the mac os developer documentation.
... update events: sent if the update region intersects the instance's bounds.
NPRect - Archive of obsolete content
description nprect defines the bounding box of the area of the plug-in window to be updated, painted, invalidated, or clipped to.
... see also npn_forceredraw() npn_invalidaterect() npn_invalidateregion() npregion npwindow ...
NPAPI plugin reference - Archive of obsolete content
npn_invalidaterect invalidates the specified portion of the plugin's drawing area, adding it to the region that needs to be redrawn when the plugin next repaints its contents.
... npn_invalidateregion invalidates the specified drawing region prior to repainting or refreshing a windowless plug-in.
Adobe Flash - Archive of obsolete content
this document is out of date.
...when information about when this problem on mac os x will be addressed becomes available, the constant can be updated to reflect something less arbitrary.
Why RSS Content Module is Popular - Including HTML Contents - Archive of obsolete content
an example using the most popular element of the rss content module is shown below: <?xml version="1.0"?> <rss version="2.0" xmlns:content="http://purl.org/rss/1.0/modules/content/" > <channel> <title>example</title> <description>an rss example with slash</description> <lastbuilddate>sun, 15 may 2005 13:02:08 -0500</lastbuilddate> <link>http://www.example.com</link> <item> <title>a link in here</title> <guid>d77d2e80-0487-4e8c-a35d-a93f12a0ff7d:2005/05/15/114</guid> <pubdate>sun, 15 may 2005 13:02:08 -0500</pubdate> <link>http://www.example.com/blog/2005/05/15/114</link> <content...
...:encoded><![cdata[this is a <a href="http://example.com/">link</a>.]]></content:encoded> </item> <item> <title>some italics html</title> <guid>d77d2e80-0487-4e8c-a35d-a93f12a0ff7d:2005/05/15/113</guid> <pubdate>sun, 15 may 2005 10:55:12 -0500</pubdate> <link>d77d2e80-0487-4e8c-a35d-a93f12a0ff7d:2005/05/15/113</link> <content:encoded><![cdata[this is <i>italics</i>.]]></content:encoded> </item> <item> <title>some bold html</title> <guid>d77d2e80-0487-4e8c-a35d-a93f12a0ff7d:2005/05/15/112</guid> <pubdate>sun, 15 may 2005 08:14:11 -0500</pubdate> <link>http://www.example.com/blog/2005/05/15/112</link> <c...
Why Well-Formed Web RSS Module is Popular - Syndicating Your Comments - Archive of obsolete content
an example using the most popular element of the well-formed web rss module is shown below: <?xml version="1.0"> <rss version="2.0" xmlns:wfw="http://wellformedweb.org/commentapi/" > <channel> <title>example</title> <description>an rss example with wfw</description> <lastbuilddate>sun, 15 may 2005 13:02:08 -0500</lastbuilddate> <link>http://www.example.com</link> <item> <title>i like root beer</title> <guid>d77d2e80-0487-4e8c-a35d-a93f12a0ff7d:article:54321</guid> <pubdate>sun, 15 may 2005 13:02:08 -0500</pubdate> <link>http://www.example.com/article/54321</link> <wfw:commentrss>http://www.example.com/feed/rss/54321/comments</wfw:commentrss> </item> ...
... <item> <title>rain is wet</title> <guid>d77d2e80-0487-4e8c-a35d-a93f12a0ff7d:article:54320</guid> <pubdate>sun, 15 may 2005 10:55:12 -0500</pubdate> <link>http://www.example.com/article/54320</link> <wfw:commentrss>http://www.example.com/feed/rss/54320/comments</wfw:commentrss> </item> <item> <title>huh?!</title> <guid>d77d2e80-0487-4e8c-a35d-a93f12a0ff7d:article:54319</guid> <pubdate>sun, 15 may 2005 08:14:11 -0500</pubdate> <link>http://www.example.com/article/54319</link> <wfw:commentrss>http://www.example.com/feed/rss/54319/comments</wfw:commentrss> </item> </channel> </rss> the <wfw:commentrss> element is the reason that the well-formed web rss module is popular.
Security Controls - Archive of obsolete content
department of commerce title: federal information processing standard publication 200, minimum security requirements for federal information and information systems last updated date: march 2006 copyright information: this document is not subject to copyright.
... original document information author(s): karen scarfone, wayne jansen, and miles tracy title: nist special publication 800-123, guide to general server security last updated date: july 2008 copyright information: this document is not subject to copyright.
Common Firefox theme issues and solutions - Archive of obsolete content
this guide will help you thoroughly test your theme to find and fix issues before you push updates to amo.
... mozillazine firefox nightly theme changes thread mozillazine's firefox nightly theme changes thread is a great resource for keeping up to date with the latest changes to the firefox ui and contains links to the bugzilla bug reports, which detail what changes were made.
Theme changes in Firefox 3.5 - Archive of obsolete content
this article covers the changes that need to be made to update a firefox theme to work properly in firefox 3.5.
... core, browser and toolkit changes requiring theme updates there are a number of changes in the browser that may require you to make changes to your theme.
Updating an extension to support multiple Mozilla applications - Archive of obsolete content
« previousnext » this article shows how to take an existing extension and update it so that it can be used in additional mozilla applications.
...update the chrome manifest remember way back in the first article in this series when we created our chrome manifest, which we haven't touched since?
Developing cross-browser and cross-platform pages - Archive of obsolete content
as new browsers are released, it becomes necessary to make updates to such code which attempts to narrow down the browser and browser version and to make the appropriate switches.
... more on object/feature support detection: a strategy that works: object/feature detecting by comp.lang.javascript newsgroup faq notes browser detection - no; object detection - yes by peter-paul koch also good http://developer.mozilla.org/docs...rowser_support but outdated in my opinion ...
Browser Feature Detection - Archive of obsolete content
therefore, given that it's also badly out of date, it's been archived.
...port(document.body.style, 'domcss1', 'document.body.style'); generatereport(document.body.style, 'domcss2', 'document.body.style'); window.onerror = oldonerror; see also browser detection and cross browser support comparison of layout engines web specifications supported in opera 9 what's new in internet explorer 7 (script) original document information author(s): (unknown) last updated date: updated march 16, 2003 copyright information: copyright © 2001-2003 netscape.
ECMAScript 2016 to ES.Next support in Mozilla - Archive of obsolete content
this page needs to be updated to reflect current changes.
... implemented proposals not in es.next this section needs to be updated to reflect current changes.
New in JavaScript 1.7 - Archive of obsolete content
javascript 1.7 is a language update introducing several new features, in particular generators, iterators, array comprehensions, let expressions, and destructuring assignment.
...in more recent firefox versions, the implementation is updated to work with semantics as specified in ecmascript edition 6.
New in JavaScript 1.8.5 - Archive of obsolete content
bug 510537 date.prototype.tojson() returns a json format string for a date object.
... changed functionality in javascript 1.8.5 iso 8601 support in date: the date object's parse() method now supports simple iso 8601 format date strings.
LiveConnect - Archive of obsolete content
documentation java plugin - liveconnect documentation this is likely the most up-to-date documentation of liveconnect.
... mailing list newsgroup rss feed related topics javascript, plugins older notes (please update or remove as needed.) while the bloated liveconnect code in the mozilla source was removed in version 1.9.2 of the platform (see bug 442399), its former api has been restored (see also the specification and this thread) (building on npapi?), and as of java 6 update 12, extensions as well as applets can make use of this restored api.
XForms Output Element - Archive of obsolete content
calendar - used to represent instance data of type date (xhtml/xul).
...characteristics the bound instance node is of type xsd:date or a type derived from it in addition, the appearance attribute must also contain the value "full" firefox 2.0 doesn't currently have any similar widgets available for use with xhtml or xul.
XForms Range Element - Archive of obsolete content
type restrictions the range element can be bound to a node of type xsd:duration, xsd:date, xsd:time, xsd:datetime, xsd:gyearmonth, xsd:gyear, xsd:gmonthday, xsd:gday, xsd:gmonth, xsd:float, xsd:decimal or xsd:double or any type derived from one of these.
...characteristics analogous widget is <xul:scale/>, which is available in fx 3.0 only if the incremental attribute has the value true, the value of the bound node will be updated upon each movement of the slider's thumb.
Fixing Table Inheritance in Quirks Mode - Archive of obsolete content
it is also fully valid css2 and so will validate without incident.
...meyer, netscape communications last updated date: published 26 nov 2002 copyright information: copyright © 2001-2003 netscape.
RDF in Mozilla FAQ - Archive of obsolete content
statements about the same rdf resource can then be intermingled: for example, the "last visit date" of a particular website comes from the "browser global history" datasource, and the "shortcut keyword" that you can type to reach that website comes from the "browser bookmarks" datasource.
... contributors examples section added 2002-07-02 by danbri thanks to myk melez for notes on remote xul / security policy author: chris waterson original document information author(s): chris waterson last updated date: december 22, 2004 copyright information: copyright (c) chris waterson ...
The Business Benefits of Web Standards - Archive of obsolete content
happier staff good developers - both agency and inhouse - simply do not want to work using outdated methodologies and platforms with uncertain standards, with all the consequent uncertainty in quality.
... mandated accessibility being accessible is mandatory in many countries for government agencies (us, uk, canada), and --in some countries like australia-- for every organization.
Obsolete: XPCOM-based scripting for NPAPI plugins - Archive of obsolete content
warning: the content of this article may be out of date.
...ranganathan last updated date: october 26, 2001 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
XUL Parser in Python - Archive of obsolete content
warning: the content of this article may be out of date.
...i guess you could get a modify date from the files as you open them.
Common causes of memory leaks in extensions - Extensions
failing to clean up event listeners extensions can be disabled and removed by user actions, but it also happens when an add-on is updated.
...when your add-on gets updated and re-enabled, the previous module version that is still loaded will be used, which might break your add-on entirely.
Game distribution - Game development
instant updates you don't have to wait several days to have your game's code updated.
... if your user finds a bug, you can quickly fix it, update the system and refresh the game on your server to provide players with the updated code almost instantly.
Bounce off the walls - Game development
add this to your code, somewhere below the existing variable declarations: var ballradius = 10; now update the line that draws the ball inside the drawball() function to this: ctx.arc(x, y, ballradius, 0, math.pi*2); bouncing off the top and bottom there are four walls to bounce the ball off — let's focus on the top one first.
...update the last code you added to this: if(x + dx > canvas.width-ballradius || x + dx < ballradius) { dx = -dx; } if(y + dy > canvas.height-ballradius || y + dy < ballradius) { dy = -dy; } when the distance between the center of the ball and the edge of the wall is exactly the same as the radius of the ball, it will change the movement direction.
Track the score and win - Game development
add the following into your javascript, after the rest of your variables: var score = 0; you also need a drawscore() function, to create and update the score display.
...for(var r=0; r<brickrowcount; r++) { var b = bricks[c][r]; if(b.status == 1) { if(x > b.x && x < b.x+brickwidth && y > b.y && y < b.y+brickheight) { dy = -dy; b.status = 0; score++; } } } } } calling drawscore() from the draw() function keeps the score up to date with every new frame — add the following line inside draw(), just below the drawpaddle() call: drawscore(); displaying a winning message when all bricks have been destroyed collecting the points works well, but you won't be adding them forever — what about when all the bricks have been destroyed?
Animations and tweens - Game development
applying the animation when the ball hits the paddle in the arcade.collide() method call that handles the collision between the ball and the paddle (the first line inside update(), see below) we can add an extra parameter that specifies a function to be executed every time the collision happens, in the same fashion as the ballhitbrick() function.
... update the first line inside update() as shown below: function update() { game.physics.arcade.collide(ball, paddle, ballhitpaddle); game.physics.arcade.collide(ball, bricks, ballhitbrick); paddle.x = game.input.x || game.world.width*0.5; } then we can create the ballhitpaddle() function (having ball and paddle as default parameters), playing the wobble animation when it is called.
Physics - Game development
add the following line, again at the bottom of create(): ball.body.velocity.set(150, 150); removing our previous update instructions remember to remove our old method of adding values to x and y from the update() function: function update() { ball.x += 1; ball.y += 1; } we are now handling this properly, with a physics engine.
... game.scale.pagealignhorizontally = true; game.scale.pagealignvertically = true; game.stage.backgroundcolor = '#eee'; game.load.image('ball', 'img/ball.png'); } function create() { game.physics.startsystem(phaser.physics.arcade); ball = game.add.sprite(50, 50, 'ball'); game.physics.enable(ball, phaser.physics.arcade); ball.body.velocity.set(150, 150); } function update() { } try reloading index.html again — the ball should now be moving constantly in the given direction.
The score - Game development
updating the score when bricks are destroyed we will increase the number of points every time the ball hits a brick and update the scoretext to display the current score.
... this can be done using the settext() method — add the two new lines seen below to the ballhitbrick() function: function ballhitbrick(ball, brick) { brick.kill(); score += 10; scoretext.settext('points: '+score); } that's it for now — reload your index.html and check that the score updates on every brick hit.
Plug-in Development Overview - Gecko Plugin API Reference
npn_invalidaterect: invalidate an area in a windowless plug-in before repainting or refreshing.
... npn_invalidateregion: invalidate an area in a windowless plug-in before repainting or refreshing.
Control flow - MDN Web Docs Glossary: Definitions of Web-related terms
for example, imagine a script used to validate user data from a webpage form.
... the script submits validated data, but if the user, say, leaves a required field empty, the script prompts them to fill it in.
Endianness - MDN Web Docs Glossary: Definitions of Web-related terms
little-endian means storing bytes in order of least-to-most-significant (where the least significant byte takes the first or lowest address), comparable to a common european way of writing dates (e.g., 31 december 2050).
... naturally, big-endian is the opposite order, comparable to an iso date (2050-12-31).
JSON - MDN Web Docs Glossary: Definitions of Web-related terms
json does not natively represent more complex data types like functions, regular expressions, dates, and so on.
... (date objects by default serialize to a string containing the date in iso format, so the information isn't completely lost.) if you need json to represent additional data types, transform values as they are serialized or before they are deserialized.
OTA - MDN Web Docs Glossary: Definitions of Web-related terms
all device owners receiving a given set of updates are on the same "channel", and each device often can access several channels (e.g.
... learn more general knowledge over-the-air programming on wikipedia creating and applying firefox os update packages ...
RSS - MDN Web Docs Glossary: Definitions of Web-related terms
rss (really simple syndication) refers to several xml document formats designed for publishing site updates.
... when you subscribe to a website's rss feed, the website sends information and updates to your rss reader in an rss document called a feed, so you don't need to check all your favorite websites manually.
WebDAV - MDN Web Docs Glossary: Definitions of Web-related terms
webdav (web distributed authoring and versioning) is an http extension that lets web developers update their content remotely from a client.
...author or creation date) link pages of any media type to related pages create sets of documents and retrieve hierarchical list copy and move webpages lock a document from being edited by more than one person at a time learn more general knowledge webdav on wikipedia technical reference rfc 2518 rfc 3253 rfc 3744 ...
Mobile accessibility - Learn web development
it is also worth considering the use of html5 form input types such as the date on mobile platforms as they handle them well — both android and ios, for example, display usable widgets that fit well with the device experience.
... types time and date display suitable pickers for selecting times and dates.
Accessible multimedia - Learn web development
last of all, add the following to the end of the code, to control the time elapsed display: player.ontimeupdate = function() { let minutes = math.floor(player.currenttime / 60); let seconds = math.floor(player.currenttime - minutes * 60); let minutevalue; let secondvalue; if (minutes<10) { minutevalue = "0" + minutes; } else { minutevalue = minutes; } if (seconds<10) { secondvalue = "0" + seconds; } else { secondvalue = seconds; } mediatime = minutevalue + ":" + sec...
...ondvalue; timelabel.textcontent = mediatime; }; each time the time updates (once per second), we fire this function.
What is accessibility? - Learn web development
for example: is my date picker widget usable by people using screen readers?
... if content updates dynamically, do visually impaired people know about it?
Debugging CSS - Learn web development
how to access browser devtools the article what are browser developer tools is an up-to-date guide explaining how to access the tools in various browsers and platforms.
...a color picker will open up and you can try out some different colors; these will update in real time on the page.
CSS values and units - Learn web development
note: at some point modern browsers were updated so that rgba() and rgb(), and hsl() and hsla() (see below), became pure aliases of each other and started to behave exactly the same.
...this takes a value from 0–100%, where 0 is no light (it will appear completely black) and 100% is full light (it will appear completely white) we can update the rgb example to use hsl colors like this: just as rgb has rgba, hsl has an hsla equivalent, which gives you the same ability to specify the alpha channel.
Responsive design - Learn web development
this meant that two separate versions of the site had to be developed and kept up-to-date.
...the media queries level 3 specification became a candidate recommendation in 2009, meaning that it was deemed ready for implementation in browsers.
HTML forms in legacy browsers - Learn web development
in the mobile world, when neither the browser nor the os can be updated such as on older android phones or iphones, the stock browsers that don't update are also legacy browsers.
...for example, if you declare input { font-size: 2rem; }, it will impact number, date, and text, but not color or range.
Test your skills: HTML5 controls - Learn web development
create appropriate inputs for a user to update their details for: email website phone number favourite color try updating the live code below to recreate the finished example: download the starting point for this task to work in your own editor or in an online editor.
...if you do this correctly, the javascript included on the page will automatically update the output value when the slider is moved.
Your first form - Learn web development
forms allow users to enter data, which is generally sent to a web server for processing and storage (see sending form data later in the module), or used on the client-side to immediately update the interface in some way (for example, add another item to a list, or show or hide a ui feature).
...gets: <form action="/my-handling-form-page" method="post"> <ul> <li> <label for="name">name:</label> <input type="text" id="name" name="user_name"> </li> <li> <label for="mail">e-mail:</label> <input type="email" id="mail" name="user_email"> </li> <li> <label for="msg">message:</label> <textarea id="msg" name="user_message"></textarea> </li> </ul> </form> update your form code to look like the above.
JavaScript basics - Learn web development
placing javascript near the bottom of an html page is one way to accommodate this dependency.
...update your setusername() function to this: function setusername() { let myname = prompt('please enter your name.'); if(!myname) { setusername(); } else { localstorage.setitem('name', myname); myheading.innerhtml = 'mozilla is cool, ' + myname; } } in human language, this means: if myname has no value, run setusername() again from the start.
The web and web standards - Learn web development
it'll take you a few months to really start to get into it, and then you'll need to keep learning so that your knowledge stays up-to-date with all the new tools and features that appear on the web platform, and keep practicing and refining your craft.
... javascript is the programming language we use to add interactivity to web sites, from dynamic style switching, to fetching updates from the server, right through to complex 3d graphics.
Debugging HTML - Learn web development
to specify the html to validate, you can provide a web address, upload an html file, or directly input some html code.
... switch to the validate by direct input tab.
Test your skills: Advanced HTML text - Learn web development
semantically associate machine-readable dates with the dates in the text.
... use subscript and superscript to provide correct semantics for the chemical formulae and dates, and make them display correctly.
Test your skills: Functions - Learn web development
you'll want to clear the canvas before drawing, so that when the code is updated in the case of the live version, you don't get lots of rectangles drawn on top of one another.
... update the choosename() function so that it makes use of the random number function, takes the array to choose from as a parameter (making it more flexible), and returns the result.
Video and Audio APIs - Learn web development
to do this we'll run a function to update the time displays every time the timeupdate event is fired on the <video> element.
... add the following addeventlistener() line just below the others: media.addeventlistener('timeupdate', settime); now to define the settime() function.
Test your skills: Math - Learn web development
go back and update the original calculations you were provided with so that they give this final result.
... don't update the numbers or the operators.
JavaScript object basics - Learn web development
let's update the javascript object in our file to look like this: const person = { name: ['bob', 'smith'], age: 32, gender: 'male', interests: ['music', 'skiing'], bio: function() { alert(this.name[0] + ' ' + this.name[1] + ' is ' + this.age + ' years old.
... setting object members so far we've only looked at retrieving (or getting) object members — you can also set (update) the value of object members by simply declaring the member you want to set (using dot or bracket notation), like this: person.age = 45; person['name']['last'] = 'cratchit'; try entering the above lines, and then getting the members again to see how they've changed, like so: person.age person['name']['last'] setting members doesn't just stop at updating the values of existing properties and m...
Test your skills: Object basics - Learn web development
update the color property value to black.
... once you've done this, you should then write a string to the variable bandinfo, which will contain a small biography detailing their name, nationality, years active, and style, and the title and release date of their first album.
Aprender y obtener ayuda - Learn web development
if you want to find out more about a specific technology feature, such as the html <video> element, or the css background-color or opacity properties, or the javascript date.settime() method, you should just search for the feature's name.
... if you are looking for some more specific information, you can add other keywords as modifiers, for example "<video> element autoplay attribute", or "date.settime parameters".
Properly configuring server MIME types - Learn web development
this article may contain out of date information, as it has not been significantly updated in many years.
... related links incorrect mime type for css files iana | mime media types hypertext transfer protocol — http/1.1 microsoft - 293336 - info: webcast: mime type handling in microsoft internet explorer microsoft - appendix a: mime type detection in internet explorer microsoft - security update, march 29, 2001 microsoft - security update, december 13, 2001 original document information author: bob clary, date: 20 feb 2003 ...
Introduction to the server side - Learn web development
it can even allow interaction with users of the site, sending notifications and updates via email or through other channels.
... because the information is in a database, it can also more easily be shared and updated with other business systems (for example, when products are sold either online or in a shop, the shop might update its database of inventory).
Server-side web frameworks - Learn web development
an http post request to update a resource on the server will instead include the update information as "post data" within the body of the request.
...because everything is included, it all works together, follows consistent design principles, and has extensive and up-to-date documentation.
Ember resources and troubleshooting - Learn web development
general troubleshooting, gotchas, and misconceptions this is nowhere near an extensive list, but it is a list of things that came up around the time of writing (latest update, may 2020).
... with ember-set-helper: <checkbox @value={{this.somedata}} @ontoggle={{set this "somedata" (not this.somedata)}} /> with ember-box: {{#let (box this.somedata) as |somedata|}} <checkbox @value={{unwrap somedata}} @ontoggle={{update somedata (not this.somedata)}} /> {{/let}} note that none of these solutions are particularly common among members of the community, and as a whole, people are still trying to figure out an ergonomic and simple api for setting data in a template-only context, without backing js.
Strategies for carrying out testing - Learn web development
you probably want to just test the latest versions of the first three, as these browsers receive regular updates.
... there are also commercial tools available such as sauce labs, browser stack and lambdatest that do this kind of thing for you, without you having to worry about the setup, if you wish to invest some money in your testing.
Git and GitHub - Learn web development
overview vcses are essential for software development: it is rare that you will work on a project completely on your own, and as soon as you start working with other people you start to run the risk of conflicting with each other's work — this is when both of you try to update the same piece of code at the same time.
... mastering issues (from github) issues are like a forum for your github project, where people can ask questions and report problems, and you can manage updates (for example assigning people to fix issues, clarifying the issue, letting people know things are fixed).
Command line crash course - Learn web development
it is also useful for automation — for example to write a command to update the titles of hundreds of files instantly, say from “ch01-xxxx.png” to “ch02-xxxx.png”.
... if you updated the file names using your finder or explorer gui app, it would take you a long time.
Mozilla’s UAAG evaluation report
this document is based on the september 12, 2001 candidate recommendation of uaag 1.0.
... this may be different from the most recent version, check for updates on the user agent working group home page.
Adding phishing protection data providers
browser.safebrowsing.provider.idnum.updateurl an url used to request an updated list of phishing sites.
... the server either provides a full list or incremental updates in order to bring the client's tables up to date.
A bird's-eye view of the Mozilla framework
tiner last updated date: 11/23/05 statement of purpose the purpose of this article is to provide a high-level technical overview of the architecture of the extensible, object-based mozilla application framework.
...release() decrements the reference count and then the object becomes a candidate for destruction.
Command line options
-showdate date show your schedule of the given date.
... sunbird -showdate 08/04/2008 -subscribe url or -url url subscribe to the given url.
Debugging on Mac OS X
these steps were last updated for xcode 10.3: open xcode, and create a new project with file > new project.
...# breakpoint set --name nsthread::processnextevent --thread-index 1 --auto-continue true --one-shot true breakpoint command add -s python # this script that we run does not work if we try to use the global 'lldb' # object, since it is out of date at the time that the script runs (for # example, `lldb.target.executable.fullpath` is empty).
Old Thunderbird build
then run "python client.py checkout" to ensure you are up-to-date.
...to run the executable from your comm-central working directory: windows: obj-.../dist/bin/thunderbird.exe linux: obj-.../dist/bin/thunderbird os x: obj-.../dist/daily.app/contents/macos/thunderbird how to update and build again in your comm-central directory, run the same command as before: python client.py checkout then just re-run the mach command above.
Simple Instantbird build
then run python client.py checkout to ensure you are up-to-date.
...to run the executable from your comm-central working directory: windows: obj-.../dist/bin/instantbird.exe linux: obj-.../dist/bin/instantbird os x: obj-.../dist/instantbird.app/contents/macos/instantbird how to update and build again simply re-run the mach command above.
The Firefox codebase: CSS Guidelines
it is also good practice to look at whether the rule you are overriding is still needed: maybe the ux spec for the component has changed and that rule can actually be updated or removed.
... when this is the case, don't be afraid to remove or update that rule.
Listening to events on all tabs
optional from gecko 10 onprogresschange called when updated progress information for the download of a document is available.
... void onprogresschange( nsidomxulelement abrowser, nsiwebprogress awebprogress, nsirequest arequest, print32 acurselfprogress, print32 amaxselfprogress, print32 acurtotalprogress, print32 amaxtotalprogress ); parameters abrowser the browser representing the tab for which updated progress information is being provided.
Reviewer Checklist
idl uuids are updated when the interface is updated.
... android permissions should be 'grouped' into a common release to avoid breaking auto-updates.
Working with Mozilla source code
interface development guide guidelines and documentation for how to create and update xpcom interfaces.
...this article needs to be updated fully for mercurial.
Multiple Firefox profiles
while using the nightly channel, you may encounter some add-ons that have become temporarily incompatible with new api changes, until the add-on developer has a chance to update them.
...it takes little time to set up a new profile, and once it is complete, all of your firefox versions will update separately and can be run simultaneously.
Using the Browser API
MozillaGeckoChromeAPIBrowser APIUsing
notice that this is also where we call the canmovebwd() and canmovefwd() functions we discussed earlier — it makes sense to update the status of the back and forward buttons after each page reload.
... back to the stop/reload button — updating the icon is nice, but we also need to update the functionality that is invoked when each icon is displayed.
MozBeforePaint
once you've called this, the mozbeforepaint event will be fired one time, when it's time for animations to be updated for the window's next animation frame.
...this computes the current position for the animating box and updates the box's position on screen, and, if the animation sequence is not yet complete, calls window.requestanimationframe() to schedule the next animation frame to be drawn.
Roll your own browser: An embedding how-to
warning: this document is out of date.
... original document information author(s): doug turner original document: , , and last updated date: december 8, 2004 copyright information: copyright (c) doug turner ...
Gecko Keypress Event
because numerals are common in short cuts, the numeral from the key should be considered as a low priority shortcut key candidate (bug 429219).
...it is better to use the logic already in nscontentutils::getaccelkeycandidates() for accel key handling, and nscontentutils::getaccesskeycandidates() for access key handling (see nscontentutils.h and nscontentutils.cpp).
Gecko's "Almost Standards" Mode
recommendations for authors who are attempting to migrate to validated markup using either html 4.01 or xhtml 1.0, and who are still using image-in-table design concepts, make sure to use a doctype that will trigger "almost standards" mode.
...meyer, netscape communications last updated date: published 08 nov 2002 copyright information: copyright © 2001-2003 netscape.
Hacking with Bonsai
there is a web page, which records if the tree is open or closed what the date stamp of the last known good tree is who is on the hook for the current tree before the tree is opened, the list of checkins that happened when the tree was closed is reviewed to insure that only build related checkins took place.
...when the tree is re-opened, the web page is updated and the hook is cleared.
Introduction to Layout in Mozilla
et frame child rs.reason set based on rc’s type incremental reflow propagate damage to frames later “in the flow” incremental reflow multiple reflow commands are batched nsreflowpath maintains a tree of target frames amortize state recovery and damage propagation cost painting as reflow proceeds through the frame hierarchy, areas are invalidated via nsiviewmanager::updateview unless immediate, invalid areas are coalesced and processed asynchronously via os expose event native expose event dispatched to widget; widget delegates to the view manager view manager paints views back-to-front, invoking presshell’s paint method presshell::paint walks from the view to the frame; invokes nsiframe::paint for each layer incrementalism ...
... original document information author(s): chris waterson last updated date: june 10, 2002 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Log.jsm
until stabilized, expect frequent updates, including different interfaces and behavior in different versions of the platform.
... logmessage(); length: 4 keys of prototype: leveldesc logger(); length: 2 keys of prototype: addappender(); level logstructured(); name parent removeappender(); updateappenders(); and the methods mentioned below: logger methods loggerrepository(); length: 0 keys of prototype: getlogger(); rootlogger storagestreamappender(); length: 1 keys of prototype: doappend(); getinputstream(); ...
PopupNotifications.jsm
this lets the notification service update the active notifications as appropriate.
...for most use cases, the value of this parameter should be date.now() plus an offset indicating the amount of time the notification should be kept open (for example, date.now() + 30000 for 30 seconds).
Bootstrapping a new locale
mkdir -p ab-cd/browser/installer ab-cd/browser/profile/chrome ab-cd/browser/searchplugins ab-cd/browser/updater ab-cd/toolkit cp -r mozilla-1.9.x/browser/locales/ ab-cd/browser cp -r mozilla-1.9.x/dom/locales/ ab-cd/dom cp -r mozilla-1.9.x/editor/locales/ ab-cd/editor cp -r mozilla-1.9.x/extensions/reporter/locales/chrome ab-cd/extensions cp -r mozilla-1.9.x/netwerk/locales/ ab-cd/netwerk cp -r mozilla-1.9.x/other-licenses/branding/firefox/locales/ ab-cd/other-licenses cp -r mozilla-1.9.x/security/manager...
...$ hg pull -u # to pull changes and update $ hg push # to push changes to this repo import existing data?
Localization technical reviews
the merge date for migrating from one product release channel to the next (e.g., aurora to beta, or beta to release) is rapidly approaching.
...when you update your localization for the next release, you'll need to put it through a different form of qa review called a sign-off review.
MathML Torture Test
h { font-family: minion math; } .stixtwo math { font-family: stix two math; } .texgyrebonum math { font-family: tex gyre bonum math; } .texgyrepagella math { font-family: tex gyre pagella math; } .texgyreschola math { font-family: tex gyre schola math; } .texgyretermes math { font-family: tex gyre termes math; } .xits math { font-family: xits math; } javascript content function updatemathfont() { var mathfont = document.getelementbyid("mathfont").value; if (mathfont == "default") { document.body.removeattribute("class"); } else { document.body.setattribute("class", mathfont); } } function load() { document.getelementbyid("mathfont").
... addeventlistener("change", updatemathfont, false) } window.addeventlistener("load", load, false); the following test contains sample tex formulas from knuth's tex book and equivalent mathml representations.
Mozilla MathML Project
updates status of each tag result of the mathml 3 testsuite unofficial nightly builds with mathml patches applied (maintained by bill gianopoulos) more updates and archived content community view mozilla forums...
...sidje other contributors: frédéric wang last updated date: april 4, 2010 copyright information: portions of this content are © 1999–2010 by individual mozilla.org contributors; content available under a creative commons license | details.
Mozilla DOM Hacking Guide
i will try to update this guide as soon as possible.
... original document information author(s): fabian guisset last updated date: september 27, 2007 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Mozilla Style System Documentation
it should be consolidated so that the style system code can be moved back within the layout dll and nsistylecontext can be de-com-ified.
...david baron last updated date: june 6, 2003 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Scroll-linked effects
in the asynchronous scrolling model, the visual scroll position is updated in the compositor thread and is visible to the user before the scroll event is updated in the dom and fired on the main thread.
...one way to implement this without the scroll event listener is to use the css property designed for this purpose: <body style="height: 5000px"> <div id="toolbar" style="position: sticky; top: 0px; margin-top: 100px; width: 100px; height: 20px; background-color: green"></div> </body> this version works well with asynchronous scrolling because position of the "toolbar" div is updated by the browser as the user scrolls.
A brief guide to Mozilla preferences
ion directory: greprefs.js - preferences shared by all applications using the mozilla platform services/common/services-common.js - preferences for some shared services code, this should arguably be included in some other file defaults/pref/services-sync.js - default preferences for firefox sync, also oddly misplaced browser/app/profile/channel-prefs.js - a file indicating the user's update channel.
... this is kept separate from other preferences because it can affect how updates are applied.
Patches and pushes
review, commit, & land address any review comments made by the reviewers and update the patch until it receives an r+ rating.
... update your sign-offs on the l10n dashboard to include the change into the next release.
Profile Manager
when you restore a profile, the backup is retained, so you can restore from the same backup at a later date.
... properties - shows a dialog that displays the profile's path and last-modified date.
AsyncTestUtils extended framework
this specifies the time interval we should add to the date for each message.
...because the message sets are interleaved, if you read the subject lines in the order they were added (or in date order), you would read "foo", "bar", "foo", "bar", "foo", "bar".
PR_AtomicSet
description pr_atomicset first reads the value of var, then updates it with the supplied value.
... the returned value is the value that was readbefore memory was updated.
NSPR release process
five files need to be updated: configure.in, configure, repackage.sh, prinit.h, and vercheck.c.
... usually you just need to update prinit.h.
NSS FAQ
MozillaProjectsNSSFAQ
this section is out of date iplanet e-commerce solutions has certified nss 3.1 on 18 platforms, including aix 4.3, hp-ux 11.0, red hat linux 6.0, solaris (2.6 or later), windows nt (4.0 or later), and windows 2000.
... this section is out of date yes; see build instructions for nss 3.1.
JSS
MozillaProjectsNSSJSS
the github: git clone git@github.com:dogtagpki/jss.git -- or -- git clone https://github.com/dogtagpki/jss.git all future upstream enquiries to jss should now use the pagure issue tracker system: https://pagure.io/jss/issues documentation regarding the jss project should now be viewed at: http://www.dogtagpki.org/wiki/jss note: as much of the jss documentation is sorely out-of-date, updated information will be a work in progress, and many portions of any legacy documentation will be re-written over the course of time.
...if you are planning to just use jss jce provider as a bridge to nss's fips validated pkcs#11 module, then the sunpkcs11 jce provider may do all that you need.
NSS 3.14.2 release notes
(https://bugzilla.mozilla.org/show_bug.cgi?id=540986) sqlite has been updated to 3.7.15.
... bug 618418 - c_decrypt/c_decryptfinal now correctly validate the pkcs #7 padding when present.
NSS 3.16.2.3 release notes
previously nss would only validate the peer's public key before performing ecdh key agreement.
... now ec public keys are validated at import time.
NSS 3.17.2 release notes
previously nss would only validate the peer's public key before performing ecdh key agreement.
... now ec public keys are validated at import time.
NSS 3.19.3 release notes
this is a patch release to update the list of root ca certificates.
...rprint: c4:18:f6:4d:46:d1:df:00:3d:27:30:13:72:43:a9:12:11:c6:75:fb cn = tÜrktrust elektronik sertifika hizmet saÄŸlayıcısı h6 sha1 fingerprint: 8a:5c:8c:ee:a5:03:e6:05:56:ba:d8:1b:d4:f6:c9:b0:ed:e5:2f:e0 cn = certinomis - root ca sha1 fingerprint: 9d:70:bb:01:a5:a4:a0:18:11:2e:f7:1c:01:b9:32:c5:34:e7:88:a8 the version number of the updated root ca list has been set to 2.5 bugs fixed in nss 3.19.3 this bugzilla query returns all the bugs fixed in nss 3.19.3: https://bugzilla.mozilla.org/buglist.cgi?resolution=fixed&classification=components&query_format=advanced&product=nss&target_milestone=3.19.3 compatibility nss 3.19.3 shared libraries are backward compatible with all older nss 3.19 shared libraries.
NSS 3.21 release notes
2016-01-07, this page has been updated to include additional information about the release.
...sign g2 sha1 fingerprint: fb:ed:dc:90:65:b7:27:20:37:bc:55:0c:9c:56:de:bb:f2:78:94:e1 cn = ca wosign ecc root sha1 fingerprint: d2:7a:d2:be:ed:94:c0:a1:3c:c7:25:21:ea:5d:71:be:81:19:f3:2b cn = oiste wisekey global root gb ca sha1 fingerprint: 0f:f9:40:76:18:d3:d7:6a:4b:98:f0:a8:35:9e:0c:fd:27:ac:cc:ed the version number of the updated root ca list has been set to 2.6 bugs fixed in nss 3.21 this bugzilla query returns all the bugs fixed in nss 3.21: https://bugzilla.mozilla.org/buglist.cgi?resolution=fixed&classification=components&query_format=advanced&product=nss&target_milestone=3.21 acknowledgements the nss development team would like to thank karthikeyan bhargavan from inria for responsibly disclosing the issue in b...
NSS 3.28.1 release notes
this is a patch release to update the list of root ca certificates, and address a minor tls compatibility issue, that some applications experienced with nss 3.28.
...ification authority - g4 sha-256 fingerprint: fe:86:3d:08:22:fe:7a:23:53:fa:48:4d:59:24:e8:75:65:6d:3d:c9:fb:58:77:1f:6f:61:6f:9d:57:1b:c5:92 cn = symantec class 2 public primary certification authority - g6 sha-256 fingerprint: cb:62:7d:18:b5:8a:d5:6d:de:33:1a:30:45:6b:c6:5c:60:1a:4e:9b:18:de:dc:ea:08:e7:da:aa:07:81:5f:f0 the version number of the updated root ca list has been set to 2.11 a misleading assertion/alert has been removed, when nss tries to flush data to the peer but the connection was already reset.
NSS 3.28.5 release notes
this is a patch release to update the list of root ca certificates.
...35:dd:94:57 trust flags: email cn = tubitak kamu sm ssl kok sertifikasi - surum 1 sha-256 fingerprint: 46:ed:c3:68:90:46:d5:3a:45:3f:b3:10:4a:b8:0d:ca:ec:65:8b:26:60:ea:16:29:dd:7e:86:79:90:64:87:16 trust flags: websites technically constrained to: gov.tr, k12.tr, pol.tr, mil.tr, tsk.tr, kep.tr, bel.tr, edu.tr, org.tr the version number of the updated root ca list has been set to 2.14.
NSS 3.30.2 release notes
this is a patch release to update the list of root ca certificates.
...35:dd:94:57 trust flags: email cn = tubitak kamu sm ssl kok sertifikasi - surum 1 sha-256 fingerprint: 46:ed:c3:68:90:46:d5:3a:45:3f:b3:10:4a:b8:0d:ca:ec:65:8b:26:60:ea:16:29:dd:7e:86:79:90:64:87:16 trust flags: websites technically constrained to: gov.tr, k12.tr, pol.tr, mil.tr, tsk.tr, kep.tr, bel.tr, edu.tr, org.tr the version number of the updated root ca list has been set to 2.14 (the version numbers 2.12 and 2.13 for the root ca list have been skipped.) bugs fixed in nss 3.30.2 bug 1350859 - march 2017 batch of root ca changes bug 1349705 - implemented domain name constraints for ca: tubitak kamu sm ssl kok sertifikasi - surum 1 compatibility nss 3.30.2 shared libraries are backward compatible with all older nss 3.x shared li...
NSS 3.37 release notes
nss 3.37 source distributions are available on ftp.mozilla.org for secure https download: source tarballs: https://ftp.mozilla.org/pub/mozilla.org/security/nss/releases/nss_3_37_rtm/src/ notable changes in nss 3.37 the tls 1.3 implementation was updated to draft 28.
... the ca certificates list was updated to version 2.24.
NSS 3.53 release notes
(bug 1618404, bug 1621159) if a builtin certificate has a cka_nss_server_distrust_after timestamp before the sct or notbefore date of a certificate that builtin issued, then clients can elect not to trust it.
... bug 1561331 - additional modular inverse test bug 1629553 - rework and cleanup gmake builds bug 1438431 - remove mkdepend and "depend" make target bug 290526 - support parallel building of nss when using the makefiles bug 1636206 - hacl* update after changes in libintvector.h bug 1636058 - fix building nss on debian s390x, mips64el, and riscv64 bug 1622033 - add option to build without seed this bugzilla query returns all the bugs fixed in nss 3.53: https://bugzilla.mozilla.org/buglist.cgi?resolution=fixed&classification=components&query_format=advanced&product=nss&target_milestone=3.53 compatibility nss 3.53 shared libraries are...
NSS 3.56 release notes
notable changes in nss 3.56 nspr dependency updated to 4.28.
... bug 1656519 - update nspr dependency to 4.28.
NSS Developer Tutorial
please update this list if you do.
... update nss in mozilla-inbound and mozilla-central the procedure is documented at https://developer.mozilla.org/docs/updating_nspr_or_nss_in_mozilla-central.
NSS Sample Code Sample_1_Hashing
hashtype hashtype; hashcontext *hashcontext = null; hashtype = hash_gethashtypebyoidtag(hashoidtag); hashcontext = hash_create(hashtype); if (hashcontext == null) { return secfailure; } do { hash_begin(hashcontext); /* incrementally hash the file contents */ while ((nb = pr_read(infile, ibuf, sizeof(ibuf))) > 0) { hash_update(hashcontext, ibuf, nb); } hash_end(hashcontext, digest, &len, 64); /* normally we would write it out in binary with * nb = pr_write(outfile, digest, len); * but for illustration let's print it in hex.
...d line arguments */ optstate = pl_createoptstate(argc, argv, "t:"); while ((status = pl_getnextopt(optstate)) == pl_opt_ok) { switch (optstate->option) { case 't': require_arg(optstate->option, optstate->value); hashname = strdup(optstate->value); break; } } if (!hashname) usage(progname); /* convert and validate */ hashoidtag = hashnametooidtag(hashname); if (hashoidtag == sec_oid_unknown) { fprintf(stderr, "%s: invalid digest type - %s\n", progname, hashname); usage(progname); } /* digest it and print the result */ rv = digestfile(pr_stdout, pr_stdin, hashoidtag); if (rv != secsuccess) { fprintf(stderr, "%s: problem digesting data (%d)\n", ...
NSS Sample Code Utilities_1
r (;;) { /* prompt for password */ if (istty) { fprintf(output, "%s", prompt); fflush (output); echooff(infd); } fgets(phrase, sizeof(phrase), input); if (istty) { fprintf(output, "\n"); echoon(infd); } /* stomp on newline */ phrase[port_strlen(phrase)-1] = 0; /* validate password */ if (!(*ok)(phrase)) { if (!istty) return 0; fprintf(output, "password must be at least 8 characters long with one or more\n"); fprintf(output, "non-alphabetic characters\n"); continue; } return (char*) port_strdup(phrase); } } /* * filepasswd extracts the password from a text file * * storing passwords is ...
.../* * seedfromnoisefile */ secstatus seedfromnoisefile(const char *noisefilename) { char buf[2048]; prfiledesc *fd; print32 count; fd = pr_open(noisefilename, pr_rdonly, 0); if (!fd) { fprintf(stderr, "failed to open noise file."); return secfailure; } do { count = pr_read(fd,buf,sizeof(buf)); if (count > 0) { pk11_randomupdate(buf,count); } } while (count > 0); pr_close(fd); return secsuccess; } /* * filesize */ long filesize(const char* filename) { struct stat stbuf; stat(filename, &stbuf); return stbuf.st_size; } /* * readderfromfile */ secstatus readderfromfile(secitem *der, const char *infilename, prbool ascii) { secstatus rv = secsuccess; prfiledesc *infile = n...
NSS Sample Code sample3
0xbc, sizeof data); /* create a context for hashing (digesting) */ context = pk11_createdigestcontext(sec_oid_md5); if (!context) { cout << "createdigestcontext failed" << endl; goto done; } s = pk11_digestbegin(context); if (s != secsuccess) { cout << "digestbegin failed" << endl; goto done; } s = pk11_digestop(context, data, sizeof data); if (s != secsuccess) { cout << "digestupdate failed" << endl; goto done; } s = pk11_digestfinal(context, digest, &len, sizeof digest); if (s != secsuccess) { cout << "digestfinal failed" << endl; goto done; } /* print digest */ printdigest(digest, len); pk11_destroycontext(context, pr_true); context = 0; /* * part 2 - hashing with included secret key */ cout << "part 2 -- hashing with included secret key" << endl;...
...oparams); if (!context) { cout << "createdigestcontext failed" << endl; goto done; } s = pk11_digestbegin(context); if (s != secsuccess) { cout << "digestbegin failed" << endl; goto done; } s = pk11_digestkey(context, key); if (s != secsuccess) { cout << "digestkey failed" << endl; goto done; } s = pk11_digestop(context, data, sizeof data); if (s != secsuccess) { cout << "digestupdate failed" << endl; goto done; } s = pk11_digestfinal(context, digest, &len, sizeof digest); if (s != secsuccess) { cout << "digestfinal failed" << endl; goto done; } /* print digest */ printdigest(digest, len); pk11_destroycontext(context, pr_true); context = 0; /* * part 3 - mac (with secret key) */ cout << "part 3 -- mac (with secret key)" << endl; /* initialize data...
Hashing - sample 1
hashtype hashtype; hashcontext *hashcontext = null; hashtype = hash_gethashtypebyoidtag(hashoidtag); hashcontext = hash_create(hashtype); if (hashcontext == null) { return secfailure; } do { hash_begin(hashcontext); /* incrementally hash the file contents */ while ((nb = pr_read(infile, ibuf, sizeof(ibuf))) > 0) { hash_update(hashcontext, ibuf, nb); } hash_end(hashcontext, digest, &len, 64); /* normally we would write it out in binary with * nb = pr_write(outfile, digest, len); * but for illustration let's print it in hex.
...d line arguments */ optstate = pl_createoptstate(argc, argv, "t:"); while ((status = pl_getnextopt(optstate)) == pl_opt_ok) { switch (optstate->option) { case 't': require_arg(optstate->option, optstate->value); hashname = strdup(optstate->value); break; } } if (!hashname) usage(progname); /* convert and validate */ hashoidtag = hashnametooidtag(hashname); if (hashoidtag == sec_oid_unknown) { fprintf(stderr, "%s: invalid digest type - %s\n", progname, hashname); usage(progname); } /* digest it and print the result */ rv = digestfile(pr_stdout, pr_stdin, hashoidtag); if (rv != secsuccess) { fprintf(stderr, "%s: problem digesting data (%d)\n", ...
Utilities for nss samples
r (;;) { /* prompt for password */ if (istty) { fprintf(output, "%s", prompt); fflush (output); echooff(infd); } fgets(phrase, sizeof(phrase), input); if (istty) { fprintf(output, "\n"); echoon(infd); } /* stomp on newline */ phrase[port_strlen(phrase)-1] = 0; /* validate password */ if (!(*ok)(phrase)) { if (!istty) return 0; fprintf(output, "password must be at least 8 characters long with one or more\n"); fprintf(output, "non-alphabetic characters\n"); continue; } return (char*) port_strdup(phrase); } } /* * filepasswd extracts the password from a text file * * storing passwords is ...
.../* * seedfromnoisefile */ secstatus seedfromnoisefile(const char *noisefilename) { char buf[2048]; prfiledesc *fd; print32 count; fd = pr_open(noisefilename, pr_rdonly, 0); if (!fd) { fprintf(stderr, "failed to open noise file."); return secfailure; } do { count = pr_read(fd,buf,sizeof(buf)); if (count > 0) { pk11_randomupdate(buf,count); } } while (count > 0); pr_close(fd); return secsuccess; } /* * filesize */ long filesize(const char* filename) { struct stat stbuf; stat(filename, &stbuf); return stbuf.st_size; } /* * readderfromfile */ secstatus readderfromfile(secitem *der, const char *infilename, prbool ascii) { secstatus rv = secsuccess; prfiledesc *infile = n...
sample1
type; hashcontext *hashcontext = null; hashtype = hash_gethashtypebyoidtag(hashoidtag); hashcontext = hash_create(hashtype); if (hashcontext == null) { return secfailure; } do { hash_begin(hashcontext); /* incrementally hash the file contents */ while ((nb = pr_read(infile, ibuf, sizeof(ibuf))) > 0) { hash_update(hashcontext, ibuf, nb); } hash_end(hashcontext, digest, &len, 64); /* normally we would write it out in binary with * nb = pr_write(outfile, digest, len); * but for illustration let's print it in hex.
...ts */ optstate = pl_createoptstate(argc, argv, "t:"); while ((status = pl_getnextopt(optstate)) == pl_opt_ok) { switch (optstate->option) { case 't': require_arg(optstate->option, optstate->value); hashname = strdup(optstate->value); break; } } if (!hashname) usage(progname); /* convert and validate */ hashoidtag = hashnametooidtag(hashname); if (hashoidtag == sec_oid_unknown) { fprintf(stderr, "%s: invalid digest type - %s\n", progname, hashname); usage(progname); } /* digest it and print the result */ rv = digestfile(pr_stdout, pr_stdin, hashoidtag); if (rv != secsuccess) { fprintf(stderr, "%s: problem digesting data (%d)\n", progn...
PKCS 7 functions
xr 3.2 and later sec_pkcs7createsigneddata mxr 3.2 and later sec_pkcs7decodeitem mxr 3.2 and later sec_pkcs7decoderabort mxr 3.9 and later sec_pkcs7decoderfinish mxr 3.2 and later sec_pkcs7decoderstart mxr 3.2 and later sec_pkcs7decoderupdate mxr 3.2 and later sec_pkcs7decryptcontents mxr 3.2 and later sec_pkcs7destroycontentinfo mxr 3.2 and later sec_pkcs7encode mxr 3.3 and later sec_pkcs7encodeitem mxr 3.9.3 and later sec_pkcs7encoderabort mxr 3.9 and later sec_pkcs7e...
...ncoderfinish mxr 3.2 and later sec_pkcs7encoderstart mxr 3.2 and later sec_pkcs7encoderupdate mxr 3.2 and later sec_pkcs7getcertificatelist mxr 3.2 and later sec_pkcs7getcontent mxr 3.2 and later sec_pkcs7getencryptionalgorithm mxr 3.2 and later sec_pkcs7getsignercommonname mxr 3.4 and later sec_pkcs7getsigneremailaddress mxr 3.4 and later sec_pkcs7getsigningtime mxr 3.4 and later sec_pkcs7includecertchain mxr 3.2 and later sec_pkcs7iscontentempty mxr 3.2 and later sec_pkcs7setcontent ...
Migration to HG
updated instructions for building nss with nspr can be found at: /docs/nss_reference/building_and_installing_nss/build_instructions it's best to refer to the above document to learn about the various environment variables that you might have to set to build on your platform (this part hasn't changed).
...karea cd workarea hg clone https://hg.mozilla.org/projects/nspr hg clone https://hg.mozilla.org/projects/nss cd nss # set use_64=1 on 64 bit architectures # set build_opt=1 to get an optimized build make nss_build_all note that the jss project has been given a private copy of the former mozilla/security/coreconf directory, allowing it to remain stable, and only update its build system as necessary.
NSS reference
random number generation this api consists of the two routines used for pseudorandom number generation -- pk11_generaterandomonslot and pk11_generaterandom -- and the two routines used for seeding pseudorandom number generation -- pk11_seedrandom and pk11_randomupdate.
... sec_pkcs12createexportcontext sec_pkcs12createpasswordprivsafe sec_pkcs12createunencryptedsafe sec_pkcs12addcertandkey sec_pkcs12addpasswordintegrity sec_pkcs12enablecipher sec_pkcs12encode sec_pkcs12destroyexportcontext sec_pkcs12decoderstart sec_pkcs12decoderimportbags sec_pkcs12decoderupdate sec_pkcs12decoderfinish sec_pkcs12decodervalidatebags sec_pkcs12decoderverify sec_pkcs12decodergetcerts sec_pkcs12decodersettargettokencas sec_pkcs12decoderiterateinit sec_pkcs12decoderiteratenext sec_pkcs12isencryptionallowed sec_pkcs12setpreferredcipher nspr functions a small number of nspr functions are required for using the certificate verification and ssl functions in nss.
S/MIME functions
nss_cmscontentinfo_setcontent_envelopeddata mxr 3.2 and later nss_cmscontentinfo_setcontent_signeddata mxr 3.2 and later nss_cmsdecoder_cancel mxr 3.2 and later nss_cmsdecoder_finish mxr 3.2 and later nss_cmsdecoder_start mxr 3.2 and later nss_cmsdecoder_update mxr 3.2 and later nss_cmsdigestcontext_cancel mxr 3.2 and later nss_cmsdigestcontext_finishmultiple mxr 3.2 and later nss_cmsdigestcontext_finishsingle mxr 3.2 and later nss_cmsdigestcontext_startmultiple mxr 3.2 and later nss_cmsdigestcontext_startsingle ...
... mxr 3.2 and later nss_cmsdigestcontext_update mxr 3.2 and later nss_cmsdigesteddata_create mxr 3.2 and later nss_cmsdigesteddata_destroy mxr 3.2 and later nss_cmsdigesteddata_getcontentinfo mxr 3.2 and later nss_cmsderencode mxr 3.2 and later nss_cmsencoder_cancel mxr 3.2 and later nss_cmsencoder_finish mxr 3.2 and later nss_cmsencoder_start mxr 3.2 and later nss_cmsencoder_update mxr 3.2 and later nss_cmsencrypteddata_create mxr 3.2 and later nss_cmsencrypteddata_destroy mxr 3.2 an...
NSS Tools certutil
-n nickname specify the nickname of a certificate or key to list, create, add to a database, modify, or validate.
... c6:f9:54:af:28:56:62:f4:2f:b3:9b:50:e1:c3:a2:ba:27:ee: 07:9f:89:2e:78:5c:6d:46:b6:5e:99:de:e6:9d:eb:d9:ff:b2: 5f:c6:f6:c6:52:4a:d4:67:be:8d:fc:dd:52:51:8e:a2:d7:15: 71:3e certificate trust flags: ssl flags: valid ca trusted ca email flags: valid ca trusted ca object signing flags: valid ca trusted ca validating a certificate this example validates a certificate: certutil -v -n jsmith@netscape.com -b 9803201212z -u sr -e -l -d certdir the certificate database tool shows results similar to certificate:'jsmith@netscape.com' is valid.
Scripting Java
this works just as in java, with the use of the new operator: js> new java.util.date() thu jan 24 16:18:17 est 2002 if we store the new object in a javascript variable, we can then call methods on it: js> f = new java.io.file("test.txt") test.txt js> f.exists() true js> f.getname() test.txt static methods and fields can be accessed from the class object itself: js> java.lang.math.pi 3.141592653589793 js> java.lang.math.cos(0) 1 in javascript, unlike java, the method by it...
...for example, if we call overload's method g with two integers we get an error because neither form of the method is closer to the argument types than the other: js> o.g(3,4) js:"<stdin>", line 2: the choice of java method overload.g matching javascript argument types (number,number) is ambiguous; candidate methods are: class java.lang.string g(java.lang.string,int) class java.lang.string g(int,java.lang.string) see java method overloading and liveconnect 3 for a more precise definition of overloading semantics.
Rhino shell
js> runcommand('date') thu jan 23 16:49:36 cet 2003 0 // using input option to provide process input js> runcommand("sort", {input: "c\na\nb"}) a b c 0 js> // demo of output and err options js> var opt={input: "c\na\nb", output: 'sort output:\n'} js> runcommand("sort", opt) 0 js> print(opt.output) sort output: a b c js> var opt={input: "c\na\nb", output: 'sort output:\n', err: ''} js> runcommand("sort", "--bad-arg", ...
... not found js> // passing explicit environment to the system shell js> runcommand("sh", "-c", "echo $env1 $env2", { env: {env1: 100, env2: 200}}) 100 200 0 js> // use args option to provide additional command arguments js> var arg_array = [1, 2, 3, 4]; js> runcommand("echo", { args: arg_array}) 1 2 3 4 0 examples for windows are similar: js> // invoke shell command js> runcommand("cmd", "/c", "date /t") 27.08.2005 0 js> // run sort collectiong the output js> var opt={input: "c\na\nb", output: 'sort output:\n'} js> runcommand("sort", opt) 0 js> print(opt.output) sort output: a b c js> // invoke notepad and wait until it exits js> runcommand("notepad") 0 ...
JS::DeflateStringToUTF8Buffer
if dstlenp is provided, it will be updated to hold the number of bytes written to the buffer.
... if numcharsp is provided, it will be updated to hold the number of unicode characters written to the buffer.
JS_ExecuteRegExp
a pointer to the lastindex for the execution, and received the updated lastindex.
... js_executeregexp updates the built-in regexp object's properties.
JSAPI reference
er added in spidermonkey 1.8 obsolete since jsapi 23 js_call_object_tracer added in spidermonkey 1.8 obsolete since jsapi 23 js_call_string_tracer added in spidermonkey 1.8 obsolete since jsapi 23 js_call_double_tracer added in spidermonkey 1.8 obsolete since javascript 1.8.5 js_printtracethinginfo (debug-only) added in spidermonkey 1.8 obsolete since jsapi 16 miscellaneous gc apis: js_updatemalloccounter added in spidermonkey 17 js::setlargeallocationfailurecallback added in spidermonkey 31 js::setoutofmemorycallback added in spidermonkey 31 js_enumeratediagnosticmemoryregions added in spidermonkey 17 jsval_lock obsolete since jsapi 18 jsval_unlock obsolete since jsapi 18 js_lockgcthing obsolete since jsapi 21 js_lockgcthingrt obsolete since jsapi 22 js_unlockgcthing obsol...
... jsprotokey added in spidermonkey 24 js_getclassobject js_getclassprototype js::protokeytoid added in spidermonkey 38 js_idtoprotokey added in spidermonkey 31 js::identifystandardinstance added in spidermonkey 31 js::identifystandardprototype added in spidermonkey 31 js::identifystandardinstanceorprototype added in spidermonkey 31 js::identifystandardconstructor added in spidermonkey 38 date js_newdateobject added in spidermonkey 1.8.5 js_newdateobjectmsec added in spidermonkey 1.8.5 js_objectisdate added in spidermonkey 1.8.5 js_cleardatecaches added in spidermonkey 17 js_now intl api js_setdefaultlocale added in spidermonkey 24 js_resetdefaultlocale added in spidermonkey 24 properties these functions correspond directly to the ways scripts access object properties: ...
SpiderMonkey 1.8.8
—insert-actual-release-date-here platform support spidermonkey 1.8.8 is supported on all the platforms where firefox insert-actual-firefox-version-number-here runs.
...new javascript language features javascript 1.8.8 includes significant updates to language features, yo.
Gecko Roles
role_date_editor represents control whose purpose is to allow a user to edit a date.
... role_calendar a calendar that allows the user to select a date.
Embedded Dialog API
stay tuned for updates.
... the dialog component's contract id should have the form "@mozilla.org/embedui/unique-component-name;1" original document information author: danm@netscape.com last updated date: 15 dec 2001 ...
Manipulating bookmarks using Places
you can use the nsinavbookmarksservice.changebookmarkuri() method to update the uri for a given bookmark item: var uri = ios.newuri("http://mozilla.com/", null, null); bmsvc.changebookmarkuri(newbkmkid, uri); this example changes the bookmark to refer to the mozilla web site instead of google.
... // an nsinavbookmarkobserver var myext_bookmarklistener = { onbeginupdatebatch: function() {}, onendupdatebatch: function() {}, onitemadded: function(aitemid, afolder, aindex) {}, onitemremoved: function(aitemid, afolder, aindex) {}, onitemchanged: function(abookmarkid, aproperty, aisannotationproperty, avalue) { myextension.dosomething(); }, onitemvisited: function(abookmarkid, avisitid, time) {}, onitemmoved: function(aitemid, aoldparent, aoldindex,...
Using the Places keywords API
a keyword can only be associated to a given url, it's not possible to associate the same keyword with multiple urls (doing so will just update the url it's pointing to).
... placesutils.keywords.insert({ keyword: "my_keyword", url: "http://www.example.com/" postdata: "post+data=1&test=2" }).then(() => { /* success */ }, e => { /* failure */ }); note that setting an already existing keyword to a different url, will silently update the existing keyword to the new url.
Finishing the Component
when your component runs in a version of gecko in which this interface is updated, your method calls will be routed through a different v-table than the one the component expected, most likely resulting in a crash.
...the updated weblock class looks as follows: class weblock: public nsiobserver, public iweblock, public nsicontentpolicy { public: weblock(); virtual ~weblock(); ns_decl_isupports ns_decl_nsiobserver ns_decl_iweblock ns_decl_nsicontentpolicy private: urlnode* mrooturlnode; prbool mlocked; }; remember to change the nsisupports implementation macro to include nsiconte...
Using XPCOM Utilities to Make Things Easier
using these declaration macros not only saves a tremendous amount of time when you're writing the code, it can also save time if you make changes to your idl file, since the c++ header file will then automatically include the updated list of methods to be supported.
...this raw pointer can then be assigned to a variable and have its reference updated by ns_if_addref.
Mozilla internal string guide
calling restartbulkwrite() invalidates previously-obtained span, raw pointer or length.
...it takes two arguments: the new logical length of the string (which must not exceed the capacity retuned by the length() method of the handle) and a boolean indicating whether it's ok to attempt to reallocate a smaller buffer in case a smaller mozjemalloc bucket could accommodate the new logical length.
IAccessibleText
provided for use by the ::ia2_event_text_inserted and ::ia2_event_text_updated event handlers.
...provided for use by the ia2_event_text_removed/updated event handlers.
jsdIStackFrame
after you return from that handler the bottom frame, and any frame you found attached through it, are invalidated via the jsdiephemeral interface.
... once a jsdistackframe has been invalidated all method and property accesses will throw a ns_error_not_available exception.
nsIAbCard
following a huge refactoring of the address book code, most of the documentation below is out of date.
...g used for the contact's work web page webpage2 astring used for the contact's home web page birthyear astring birthmonth astring birthday astring custom1 astring custom2 astring custom3 astring custom4 astring notes astring lastmodifieddate unsigned long popularityindex unsigned long popularityindex is bumped every time e-mail is sent to this recipient .
nsIAccessibilityService
pports aframe); nsiaccessible createhtmlcaptionaccessible(in nsisupports aframe); nsiaccessible getaccessible(in nsidomnode anode, in nsipresshell apresshell, in nsiweakreference aweakshell, inout nsiframe framehint, out boolean aishidden); nsiaccessible addnativerootaccessible(in voidptr aatkaccessible); void removenativerootaccessible(in nsiaccessible arootaccessible); void invalidatesubtreefor(in nsipresshell apresshell, in nsicontent achangedcontent, in pruint32 aevent); methods removenativerootaccessible() void removenativerootaccessible( in nsiaccessible arootaccessible ); invalidatesubtreefor() invalidate the accessibility cache associated with apresshell, for accessibles that were generated for acontainercontent and it's subtree.
... void invalidatesubtreefor( in nsipresshell apresshell, in nsicontent achangedcontent, in pruint32 aevent ); parameters <tt>apresshell</tt> the presshell where changes occured.
nsIBrowserHistory
you should use moziasynchistory.updateplaces() instead.
... adobatchnotify obsolete since gecko 9.0 if set to true, the beginupdatebatch and endupdatebatch events are sent; otherwise, no notification of changes to the history is provided.
nsICacheSession
if false, expired entries will be returned (useful for offline mode and clients, such as http, that can update the valid lifetime of cached content).
...if blockingmode is set to false, it will return ns_error_cache_wait_for_validation rather than block when another descriptor has been given write access but hasn't validated the entry yet.
nsICachingChannel
depending on the value of nsirequest.loadflags(), the cache entry may be validated, overwritten, or simply read.
...the implementation of nsicachingchannel would be expected to only read from the cache entry identified by the cache token and not try to validate it.
nsICategoryManager
var content_type = 'application/pdf'; // update the category manager in case the plugins are already loaded.
... let categorymanager = cc['@mozilla.org/categorymanager;1']; categorymanager.getservice(ci.nsicategorymanager).deletecategoryentry('gecko-content-viewers', content_type, false); // update pref manager to prevent plugins from loading in future var stringtypes = ''; var types = []; var pref_disabled_plugin_types = 'plugin.disable_full_page_plugin_for_types'; if (services.prefs.prefhasuservalue(pref_disabled_plugin_types)) { stringtypes = services.prefs.getcharpref(pref_disabled_plugin_types); } if (stringtypes !== '') { types = stringtypes.split(','); } if (types.indexof(content_type) === -1) { types.push(content_type); } services.prefs.setcharpref(pref_disabled_plugin_types, types.join(',')); remarks categories have a variety of uses throughout the mozilla platform.
nsICookieService
setcookiestring() will query the documenturi property off of nsihttpchannelinternal if supported, and setcookiestring() could also query the date header from the channel if achannel supports nsihttpchannel.
... aservertime the expiry information of the cookie (the date header from the http response).
nsIDOMGeoPositionCallback
the nsidomgeopositioncallback interface is called when updated position information is available.
...void handleevent( in nsidomgeoposition position ); parameters position an nsidomgeoposition object indicating the updated location information.
nsIDOMMozNetworkStats
start date start date of the stats samples.
... end date end date of the stats samples.
nsIDOMWindowInternal
add-ons should be updated to use nsidomwindow instead.
...if the name doesn't exist, then a new window is opened and the specified resource is loaded into its browsing context.">open(in domstring url, in domstring name, in domstring options) nsidomwindow nsisupports aextraargument) void close() void updatecommands(in domstring action) boolean find([optional] in domstring str,[optional] in boolean casesensitive, [optional] in boolean backwards, [optional] in boolean wraparound, [optional] in boolean wholeword, [optional] in boolean searchinframes, [optional] in boolean showdialog) domstring atob(in domstring aasciistring) domstring btoa(in domstring abase64data) ...
nsIDocShell
setting this attribute overrides the encoding; however, to update the dom or display of the content, you need have the data reparsed.
...an active docshell is one that is currently visible, which means it's not a good candidate for optimizations such as image frame discarding.
nsIJumpListBuilder
applications that use recent or frequent lists should keep document use tracking up to date by calling the shaddtorecentdocs shell api.
...applications that use recent or frequent lists should keep document use tracking up to date by calling the shaddtorecentdocs shell api.
nsILocale
intl/locale/idl/nsilocale.idlscriptable represents one locale, which can be used for things like sorting text strings and formatting numbers, dates and times.
...nsilocale_time - date and time formats.
nsIMsgDBHdr
date prtime indicates the date of this message; the equivalent header is the date: header.
... dateinseconds unsigned long readonly: indicates the date of this message as a unix timestamp.
nsINavHistoryResult
while the result waits to be collected it will stay in memory, and continue to update itself, potentially causing unwanted additional work.
...changing this value updates the corresponding options for the result so that reusing the current options and queries will always return results based on the current view.
nsINavHistoryVisitResultNode
it describes a visit to an entry; you can use it to determine the date and time of the last time the user visited a particular page, for example.
... 1.0 66 introduced gecko 1.9 inherits from: nsinavhistoryresultnode last changed in gecko 1.9 (firefox 3) attributes attribute type description sessionid long long the session id of the visit, used for session grouping when a tree view is sorted by date.
nsITreeColumn
nsitreecolumn getnext(); nsitreecolumn getprevious(); void invalidate(); attributes attribute type description atom nsiatom the atom attribute of nsitreecolumn which returns an nsiatom for the column, making it fast to do comparisons.
...invalidate() void invalidate(); parameters none.
nsIURIFixup
nsiuri createfixupuri( in autf8string auritext, in unsigned long afixupflags ); parameters auritext candidate uri.
... nsiuri createfixupuri( in autf8string auritext, in unsigned long afixupflags ); parameters auritext candidate uri.
nsMsgViewSortType
for example to sort by date you would pass a function the value: components.interfaces.nsmsgviewsorttype.bydate mailnews/base/public/nsimsgdbview.idlscriptable please add a summary to this article.
... last changed in gecko 1.9 (firefox 3) constants name value description bynone 0x11 not sorted bydate 0x12 bysubject 0x13 byauthor 0x14 byid 0x15 bythread 0x16 bypriority 0x17 bystatus 0x18 bysize 0x19 byflagged 0x1a byunread 0x1b byrecipient 0x1c bylocation 0x1d bytags 0x1e byjunkstatus 0x1f byattachments 0x20 byaccount 0x21 bycustom 0x22 byreceived 0x23 ...
XPCOM reference
for example to sort by date you would pass a function the value:nsmsgviewsorttypethe nsmsgviewsorttype interface contains constants used for sorting the thunderbird threadpane.
...for example to sort by date you would pass a function the value:nsmsgviewtypethe nsmsgviewtype interface contains constants used for views in thunderbird.
Working with Multiple Versions of Interfaces
the problem in this short note we illustrate how one can update an xpcom module in order for it to work in both firefox 2 and firefox 3, even if the interfaces have changed in the interim.
...mine date back to august of 2006, which is when i first built the lizard.
Buddy icons in mail
warning: the content of this article may be out of date.
... it was imported from mozilla.org and last updated in 2003.
Cached compose window FAQ
warning: the content of this article may be out of date.
... it was imported from mozilla.org and last updated in 2003.
Creating a gloda message query
gloda.daterange([lowerdate1, upperdate1], [lowerdate2, upperdate2], ...): add the constraint that the message date (per the message's date header) must fall within one of the specified inclusive ranges.
... the date instances are javascript date instances.
Mail client architecture overview
warning: the content of this article may be out of date.
... it was imported from mozilla.org and last updated in 2002.
Spam filtering
warning: the content of this article may be out of date.
... it was imported from mozilla.org and last updated in 2003.
The libmime module
warning: the content of this article may be out of date.
... it was imported from mozilla.org and last updated in 2002.
Thunderbird Binaries
trunk builds contain the very latest bleeding-edge changes and updates, as well as 64-bit builds for windows.
...trunk builds contain the very latest bleeding-edge changes and updates.
Activity Manager examples
tate = components.interfaces.nsiactivityprocess.state_completed; gactivitymanager.removeactivity(process.id); let event = components.classes["@mozilla.org/activity-event;1"].createinstance(nsiae); // localization is omitted, initiator is omitted event.init(folder.prettiestname + " is processed", null, "no junk found", process.starttime, // start time date.now()); // completion time event.contexttype = process.contexttype; // optional event.contextobj = process.contextobj; // optional gactivitymanager.addactivity(event); showing a user-defined activity with cancel capability (javascript) this sample improves the previous one by providing an nsiactivitycancelhandler to allow the user to cancel the process.
...(this example seems to be outdated and not working, see bug 557467 comment 1.) //optional: define some convenience constants const nsactprocess = components.constructor("@mozilla.org/activity-process;1", "nsiactivityprocess", "init"); const nsactevent = components.constructor("@mozilla.org/activity-event;1", "nsiactivityevent", "init"); // step...
Theme Packaging
the documentation here is out of date.
...see the install.rdf reference for more information: em:id em:version em:type em:targetapplication em:name em:internalname optional install.rdf properties em:description em:creator em:contributor em:homepageurl em:updateurl note that if your theme will be made available on the https://addons.mozilla.org website, it may not include an updateurl.
Thunderbird extensions
learn more about gloda: an overview of gloda how to create your first message query and read the gloda examples gloda internals: gloda debugging, gloda indexing more thunderbird-specific links some links may be out of date, but they still provide valuable information on the codebase.
...ibrary (obsolete as of thunderbird 52, use https://github.com/protz/thunderbird-stdlib) developing new account types useful newsgroup discussions (anything that's very old should be regarded suspiciously, because there has been significant api rewrite over the past years making most techniques considerably easier) thunderbird api docs (mostly a collection of out-of-date pages, relevance is rather dubious) general links finding the code for a feature mozillazine articles on thunderbird community / communications thunderbird specific : add-ons section on developer.thunderbird.net thunderbird communication channels add-on developers forum/mailing list #maildev irc channel more gene...
Using the Multiple Accounts API
warning: the content of this article may be out of date.
... it was imported from mozilla.org and last updated in 2003.
libmime content type handlers
warning: the content of this article may be out of date.
... it was imported from mozilla.org and last updated in 2001.
Toolkit version format
this format is used by the extension manager, software update, and other parts of the platform.
... versions in at least the following places must conform to this format: addon's and target application's version in install and update manifests.
Using tab-modal prompts
note: this part of the documentation is outdated.
... the updated prompt documentation can be found in the firefox source docs.
Add to iPhoto
some of this may change as i refine the example in the future; i'll update the article if and when that happens.
...this is done using the js-ctypes library object's declare() method, just like importing a function: this.kcftypearraycallbacks = this.lib.declare("kcftypearraycallbacks", this.cfarraycallbacks); note: for the record, this is the part that requires a nightly build of firefox 3.7a5pre dated april 16, 2010 or later; this capability was introduced in that build.
Blocking By Domain - Plugins
list contents and updates the plugin block lists are freely-licensed lists maintained by mozilla in github.
...subsequent updates to the list will be made using telemetry from firefox experiments.
Browser Side Plug-in API - Plugins
npn_invalidaterect invalidates specified drawing area prior to repainting or refreshing a windowless plug-in.
... npn_invalidateregion invalidates specified drawing region prior to repainting or refreshing a windowless plug-in.
Plug-in Development Overview - Plugins
npn_invalidaterect: invalidate an area in a windowless plug-in before repainting or refreshing.
... npn_invalidateregion: invalidate an area in a windowless plug-in before repainting or refreshing.
Version, UI, and Status Information - Plugins
displaying a status line message users are accustomed to checking the ui status line at the bottom of the browser window for updates on the progress of an operation or the url of a link on the page.
...consider using this function as part of the plug-in's smartupdate process.
Gecko Plugin API Reference - Plugins
npn_invalidaterect invalidates specified drawing area prior to repainting or refreshing a windowless plug-in.
... npn_invalidateregion invalidates specified drawing region prior to repainting or refreshing a windowless plug-in.
Cookies - Firefox Developer Tools
last accessed — date and time when the cookie was last read.
... created — date and time when the cookie was created.
Console messages - Firefox Developer Tools
synchronous and asynchronous reflows if a change is made that invalidates the current layout — for example, the browser window is resized or some javascript modifies an element's css — the layout is not recalculated immediately.
...us, reflow, when it calls window.getcomputedstyle(thing).height: var thing = document.getelementbyid("the-thing"); thing.style.display = "inline-block"; var thingheight = window.getcomputedstyle(thing).height; because of this, it's a good idea to avoid interleaving write and read calls to an element's styles when manipulating the dom, because every time you read back a style that has been invalidated by a previous write call, you force a synchronous reflow.
Rich output - Firefox Developer Tools
in particular, it: provides extra information for certain types enables detailed examination of the object's properties provides richer information for dom elements, and enables you to select them in the inspector type-specific rich output the web console provides rich output for many object types, including the following: object array date promise regexp window document element event examining object properties when an object is logged to the console it has a right-pointing triangle next to it, indicating that it can be expanded.
...for example, by expanding the array in the above list, i get the following: console.log(todolist) (4) […] ​ 0: object { status: "done", description: "morning pages", datecreated: 1552404478137 } ​ 1: object { status: "in progress", description: "refactor styles", datecreated: 1552404493169 } ​ 2: object { status: "to do", description: "create feedback form", datecreated: 1552404512630 } ​ 3: object { status: "to do", description: "normalize table", datecreated: 1552404533790 } ​ length: 4 ​ <prototype>: array [] debugger eval code:1:9 undefined highligh...
about:debugging (before Firefox 68) - Firefox Developer Tools
updating a temporary add-on if you install the add-on in this way, what happens when you update the add-on's files?
...as soon as a worker is registered, the listing is updated: before firefox 47, service workers were only shown when they were actually running.
about:debugging - Firefox Developer Tools
updating a temporary extension if you install an extension in this way, what happens when you update the extension?
...until such time as firefox for android is updated to a newer major release, in synch with desktop firefox, you should use one of the following firefox for android versions: firefox preview, if your desktop firefox is the main release or developer edition firefox for android nightly if you prefer to test with the main release of firefox for android (i.e., based on release 68), you can do so with the desktop firefox extended support release...
AbsoluteOrientationSensor - Web APIs
specifications specification status comment generic sensor api candidate recommendation defines sensors in general.
... candidate recommendation ...
AbsoluteOrientationSensor - Web APIs
} else { console.log("no permissions to use absoluteorientationsensor."); } }); specifications specification status comment generic sensor api candidate recommendation defines sensors in general.
... candidate recommendation ...
Accelerometer.Accelerometer() - Web APIs
specifications specification status comment generic sensor api candidate recommendation defines sensors in general.
... candidate recommendation ...
Accelerometer.x - Web APIs
WebAPIAccelerometerx
ometer({frequency: 60}); accelerometer.addeventlistener('reading', e => { console.log("acceleration along the x-axis " + accelerometer.x); console.log("acceleration along the y-axis " + accelerometer.y); console.log("acceleration along the z-axis " + accelerometer.z); }); accelerometer.start(); specifications specification status comment generic sensor api candidate recommendation defines sensors in general.
... candidate recommendation ...
Accelerometer.y - Web APIs
WebAPIAccelerometery
ometer({frequency: 60}); accelerometer.addeventlistener('reading', e => { console.log("acceleration along the x-axis " + accelerometer.x); console.log("acceleration along the y-axis " + accelerometer.y); console.log("acceleration along the z-axis " + accelerometer.z); }); accelerometer.start(); specifications specification status comment generic sensor api candidate recommendation defines sensors in general.
... candidate recommendation ...
Accelerometer.z - Web APIs
WebAPIAccelerometerz
ometer({frequency: 60}); accelerometer.addeventlistener('reading', e => { console.log("acceleration along the x-axis " + accelerometer.x); console.log("acceleration along the y-axis " + accelerometer.y); console.log("acceleration along the z-axis " + accelerometer.z); }); accelerometer.start(); specifications specification status comment generic sensor api candidate recommendation defines sensors in general.
... candidate recommendation ...
Accelerometer - Web APIs
let acl = new accelerometer({frequency: 60}); acl.addeventlistener('reading', () => { console.log("acceleration along the x-axis " + acl.x); console.log("acceleration along the y-axis " + acl.y); console.log("acceleration along the z-axis " + acl.z); }); acl.start(); specifications specification status comment generic sensor api candidate recommendation defines sensors in general.
... candidate recommendation ...
AmbientLightSensor.AmbientLightSensor() - Web APIs
specifications specification status comment generic sensor api candidate recommendation defines sensors in general.
... candidate recommendation ...
AmbientLightSensor.illuminance - Web APIs
example if ( 'ambientlightsensor' in window ) { const sensor = new ambientlightsensor(); sensor.onreading = () => { console.log('current light level:', sensor.illuminance); }; sensor.onerror = (event) => { console.log(event.error.name, event.error.message); }; sensor.start(); } specifications specification status comment generic sensor api candidate recommendation defines sensors in general.
... candidate recommendation ...
AmbientLightSensor - Web APIs
example if ( 'ambientlightsensor' in window ) { const sensor = new ambientlightsensor(); sensor.onreading = () => { console.log('current light level:', sensor.illuminance); }; sensor.onerror = (event) => { console.log(event.error.name, event.error.message); }; sensor.start(); } specifications specification status comment generic sensor api candidate recommendation defines sensors in general.
... candidate recommendation ...
AudioContext.createMediaElementSource() - Web APIs
when the mouse pointer is moved, the updatepage() function is invoked, which calculates the current gain as a ratio of mouse y position divided by overall window height.
...ourcenode // feed the htmlmediaelement into it var source = audioctx.createmediaelementsource(myaudio); // create a gain node var gainnode = audioctx.creategain(); // create variables to store mouse pointer y coordinate // and height of screen var cury; var height = window.innerheight; // get new mouse pointer coordinates when mouse is moved // then set new gain value document.onmousemove = updatepage; function updatepage(e) { cury = (window.event) ?
AudioTrackList.onchange - Web APIs
example this snippet establishes a handler for the change event that looks at each of the tracks in the list, calling a function to update the state of a user interface control that indicates the current state of the track.
... var tracklist = document.queryselector("video").audiotracks; tracklist.onchange = function(event) { tracklist.foreach(function(track) { updatetrackenabledbutton(track.id, track.enabled); }); }; the updatetrackenabledbutton(), in this example, should be a function that finds a user interface control using the track's id (perhaps the app uses the track id as the control element's id) and the track's enabled flag to determine which state the control should be in now.
AudioTrackList - Web APIs
to keep it up to date, handlers for the addtrack and removetrack events are set up.
... audiotracks.onaddtrack = updatetrackcount; audiotracks.onremovetrack = updatetrackcount; function updatetrackcount(event) { trackcount = audiotracks.length; drawtrackcountindicator(trackcount); } specifications specification status comment html living standardthe definition of 'audiotracklist' in that specification.
BatteryManager.onchargingchange - Web APIs
these events occur when the battery charging state is updated.
...ontent navigator.getbattery().then(function(battery) { battery.onchargingchange = chargingchange(); function chargingchange() { document.queryselector('#level').textcontent = battery.level; document.queryselector('#chargingtime').textcontent = battery.chargingtime; } }); specifications specification status comment battery status api candidate recommendation initial definition ...
BatteryManager.onchargingtimechange - Web APIs
these events occur when the battery chargingtime is updated.
...etbattery().then(function(battery) { battery.onchargingtimechange = chargingtimechange(); function chargingtimechange(){ document.queryselector('#level').textcontent = battery.level; document.queryselector('#chargingtime').textcontent = battery.chargingtime; } }); specifications specification status comment battery status api candidate recommendation initial definition ...
BatteryManager.ondischargingtimechange - Web APIs
these events occur when the battery dischargingtime is updated.
...ry().then(function(battery) { battery.ondischargingtimechange = dischargingtimechange; function dischargingtimechange(){ document.queryselector('#level').textcontent = battery.level; document.queryselector('#chargingtime').textcontent = battery.chargingtime; } }); specifications specification status comment battery status api candidate recommendation initial definition ...
BatteryManager.onlevelchange - Web APIs
these events occur when the battery level is updated.
...battery.charging) { document.queryselector('#statebaterry').textcontent = "charging time: " + (battery.chargingtime / 60); } else { document.queryselector('#statebaterry').textcontent = "discharging time: " + (battery.dischargingtime / 60); } }; }); specifications specification status comment battery status api candidate recommendation initial definition ...
CSSStyleSheet - Web APIs
cssrules read only returns a live cssrulelist which maintains an up-to-date list of the cssrule objects that comprise the stylesheet.
... rules read only the rules property is functionally identical to the standard cssrules property; it returns a live cssrulelist which maintains an up-to-date list of all of the rules in the style sheet.
CSS Object Model (CSSOM) - Web APIs
screen orientation api working draft css fonts module level 3 candidate recommendation css animations working draft css transitions working draft css custom properties for cascading variables module level 1 candidate recommendation css conditional rules module level 3 candidate recommendation defined the css interface.
... css device adaptation working draft css counter styles level 3 candidate recommendation document object model (dom) level 2 style specification obsolete initial definition.
Using the CSS Typed Object Model - Web APIs
update the javascript on line 2 to select the <p> rather than the <a>.
... .get() method / custom properties let's update our example to only retrieve a few properties and values.
DeprecationReportBody - Web APIs
anticipatedremoval a date object (rendered as a string) representing the date when the feature is expected to be removed from the current browser.
... if the date is not known, this property will return null.
Document.evaluate() - Web APIs
WebAPIDocumentevaluate
modifying a node will invalidate the iterator.
...modifying the document doesn't invalidate the snapshot; however, if the document is changed, the snapshot may not correspond to the current state of the document, since nodes may have moved, been changed, added, or removed.
Introduction to the DOM - Web APIs
you can update the contents of the test() function as needed, create more buttons, or add elements as necessary.
... figure 0.1 sample dom test page in this example, the drop-down menus dynamically update such dom—accessible aspects of the web page as its background color (bgcolor), the color of the hyperlinks (alink), and color of the text (text).
Element - Web APIs
WebAPIElement
compositionupdate fired when a new character is received in the context of a text composition session controlled by a text composition system such as an input method editor.
... candidate recommendation added the requestpointerlock() method.
EventSource - Web APIs
for example, eventsource is a useful approach for handling things like social media status updates, news feeds, or delivering data into a client-side storage mechanism like indexeddb or web storage.
... const sse = new eventsource('/api/v1/sse'); /* this will listen only for events * similar to the following: * * event: notice * data: useful data * id: someid * */ sse.addeventlistener("notice", function(e) { console.log(e.data) }) /* similarly, this will listen for events * with the field `event: update` */ sse.addeventlistener("update", function(e) { console.log(e.data) }) /* the event "message" is a special case, as it * will capture events without an event field * as well as events that have the specific type * `event: message` it will not trigger on any * other event type.
FetchEvent - Web APIs
if it finds a match in the cache, it asynchronously updates the cache for next time.
... const cache = await caches.open('dynamic-v1'); const cachedresponse = await cache.match(event.request); if (cachedresponse) { // if we found a match in the cache, return it, but also // update the entry in the cache in the background.
GeolocationCoordinates.longitude - Web APIs
from the geolocationposition object, we obtain the user's latitude and longitude using position.coords.latitude and position.coords.longitude so we can update the displayed coordinates.
... the two <span> elements are updated to display the corresponding values after being converted to a value with two decimal places.
GlobalEventHandlers - Web APIs
globaleventhandlers.ontimeupdate is an eventhandler representing the code to be called when the timeupdate event is raised.
... candidate recommendation adds onpointerlockchange and onpointerlockerror on document.
Gyroscope.Gyroscope() - Web APIs
specifications specification status comment generic sensor api candidate recommendation defines sensors in general.
... candidate recommendation ...
Gyroscope.x - Web APIs
WebAPIGyroscopex
new gyroscope({frequency: 60}); gyroscope.addeventlistener('reading', e => { console.log("angular velocity along the x-axis " + gyroscope.x); console.log("angular velocity along the y-axis " + gyroscope.y); console.log("angular velocity along the z-axis " + gyroscope.z); }); gyroscope.start(); specifications specification status comment generic sensor api candidate recommendation defines sensors in general.
... candidate recommendation ...
Gyroscope.y - Web APIs
WebAPIGyroscopey
new gyroscope({frequency: 60}); gyroscope.addeventlistener('reading', e => { console.log("angular velocety along the x-axis " + gyroscope.x); console.log("angular velocety along the y-axis " + gyroscope.y); console.log("angular velocety along the z-axis " + gyroscope.z); }); gyroscope.start(); specifications specification status comment generic sensor api candidate recommendation defines sensors in general.
... candidate recommendation ...
Gyroscope.z - Web APIs
WebAPIGyroscopez
new gyroscope({frequency: 60}); gyroscope.addeventlistener('reading', e => { console.log("angular velocety along the x-axis " + gyroscope.x); console.log("angular velocety along the y-axis " + gyroscope.y); console.log("angular velocety along the z-axis " + gyroscope.z); }); gyroscope.start(); specifications specification status comment generic sensor api candidate recommendation defines sensors in general.
... candidate recommendation ...
Gyroscope - Web APIs
WebAPIGyroscope
new gyroscope({frequency: 60}); gyroscope.addeventlistener('reading', e => { console.log("angular velocity along the x-axis " + gyroscope.x); console.log("angular velocity along the y-axis " + gyroscope.y); console.log("angular velocity along the z-axis " + gyroscope.z); }); gyroscope.start(); specifications specification status comment generic sensor api candidate recommendation defines sensors in general.
... candidate recommendation initial definition.
HTMLDialogElement.open - Web APIs
d="favanimal" name="favanimal"> <option></option> <option>brine shrimp</option> <option>red panda</option> <option>spider monkey</option> </select></p> </section> <menu> <button id="cancel" type="reset">cancel</button> <button type="submit">confirm</button> </menu> </form> </dialog> <menu> <button id="updatedetails">update details</button> </menu> <script> (function() { var updatebutton = document.getelementbyid('updatedetails'); var cancelbutton = document.getelementbyid('cancel'); var dialog = document.getelementbyid('favdialog'); dialog.returnvalue = 'favanimal'; function opencheck(dialog) { if(dialog.open) { console.log('dialog open'); ...
... } else { console.log('dialog closed'); } } // update button opens a modal dialog updatebutton.addeventlistener('click', function() { dialog.showmodal(); opencheck(dialog); }); // form cancel button closes the dialog box cancelbutton.addeventlistener('click', function() { dialog.close('animalnotchosen'); opencheck(dialog); }); })(); </script> note: you can find this example on github as htmldialogelement-basic (see it live also).
HTMLDialogElement.returnValue - Web APIs
<p><label>favorite animal: <select name="favanimal" required> <option></option> <option>brine shrimp</option> <option>red panda</option> <option>spider monkey</option> </select> </label></p> <menu> <button>cancel</button> <button>confirm</button> </menu> </form> </dialog> <menu> <button id="updatedetails">update details</button> </menu> <script> (function() { var updatebutton = document.getelementbyid('updatedetails'); var dialog = document.getelementbyid('favdialog'); dialog.returnvalue = 'favanimal'; function opencheck(dialog) { if (dialog.open) { console.log('dialog open'); } else { console.log('dialog closed'); ...
... } } function handleuserinput(returnvalue) { if (returnvalue === 'cancel' || returnvalue == null) { // user canceled the dialog, do nothing } else if (returnvalue === 'confirm') { // user chose a favorite animal, do something with it } } // “update details” button opens the <dialog> modally updatebutton.addeventlistener('click', function() { dialog.showmodal(); opencheck(dialog); handleuserinput(dialog.returnvalue); }); })(); </script> note: you can find this example on github as htmldialogelement-basic (see it live also).
HTMLDialogElement.show() - Web APIs
d="favanimal" name="favanimal"> <option></option> <option>brine shrimp</option> <option>red panda</option> <option>spider monkey</option> </select></p> </section> <menu> <button id="cancel" type="reset">cancel</button> <button type="submit">confirm</button> </menu> </form> </dialog> <menu> <button id="updatedetails">update details</button> </menu> <script> (function() { var updatebutton = document.getelementbyid('updatedetails'); var cancelbutton = document.getelementbyid('cancel'); var dialog = document.getelementbyid('favdialog'); dialog.returnvalue = 'favanimal'; function opencheck(dialog) { if(dialog.open) { console.log('dialog open'); ...
... } else { console.log('dialog closed'); } } // update button opens a modal dialog updatebutton.addeventlistener('click', function() { dialog.showmodal(); opencheck(dialog); }); // form cancel button closes the dialog box cancelbutton.addeventlistener('click', function() { dialog.close('animalnotchosen'); opencheck(dialog); }); })(); </script> specifications specification status comment html living standardthe definition of 'show()' in that specification.
HTMLDialogElement.showModal() - Web APIs
d="favanimal" name="favanimal"> <option></option> <option>brine shrimp</option> <option>red panda</option> <option>spider monkey</option> </select></p> </section> <menu> <button id="cancel" type="reset">cancel</button> <button type="submit">confirm</button> </menu> </form> </dialog> <menu> <button id="updatedetails">update details</button> </menu> <script> (function() { var updatebutton = document.getelementbyid('updatedetails'); var cancelbutton = document.getelementbyid('cancel'); var dialog = document.getelementbyid('favdialog'); dialog.returnvalue = 'favanimal'; function opencheck(dialog) { if(dialog.open) { console.log('dialog open'); ...
... } else { console.log('dialog closed'); } } // update button opens a modal dialog updatebutton.addeventlistener('click', function() { dialog.showmodal(); opencheck(dialog); }); // form cancel button closes the dialog box cancelbutton.addeventlistener('click', function() { dialog.close('animalnotchosen'); opencheck(dialog); }); })(); </script> note: you can find this example on github as htmldialogelement-basic (see it live also).
HTMLDialogElement - Web APIs
d="favanimal" name="favanimal"> <option></option> <option>brine shrimp</option> <option>red panda</option> <option>spider monkey</option> </select></p> </section> <menu> <button id="cancel" type="reset">cancel</button> <button type="submit">confirm</button> </menu> </form> </dialog> <menu> <button id="updatedetails">update details</button> </menu> <script> (function() { var updatebutton = document.getelementbyid('updatedetails'); var cancelbutton = document.getelementbyid('cancel'); var dialog = document.getelementbyid('favdialog'); dialog.returnvalue = 'favanimal'; function opencheck(dialog) { if(dialog.open) { console.log('dialog open'); ...
... } else { console.log('dialog closed'); } } // update button opens a modal dialog updatebutton.addeventlistener('click', function() { dialog.showmodal(); opencheck(dialog); }); // form cancel button closes the dialog box cancelbutton.addeventlistener('click', function() { dialog.close('animalnotchosen'); opencheck(dialog); }); })(); </script> note: you can find this example on github as htmldialogelement-basic (see it live also).
HTMLElement: beforeinput event - Web APIs
bubbles yes cancelable yes interface inputevent event handler property none sync / async sync composed yes default action update the dom element examples this example logs current value of the element immediately before replacing that value with the new one applied to the <input> element.
... html <input placeholder="enter some text" name="name"/> <p id="values"></p> javascript const input = document.queryselector('input'); const log = document.getelementbyid('values'); input.addeventlistener('beforeinput', updatevalue); function updatevalue(e) { log.textcontent = e.target.value; } result specifications specification status ui eventsthe definition of 'beforeinput event' in that specification.
HTMLElement: change event - Web APIs
depending on the kind of element being changed and the way the user interacts with the element, the change event fires at a different moment: when the element is :checked (by clicking or using the keyboard) for <input type="radio"> and <input type="checkbox">; when the user commits the change explicitly (e.g., by selecting a value from a <select>'s dropdown with a mouse click, by selecting a date from a date picker for <input type="date">, by selecting a file in the file picker for <input type="file">, etc.); when the element loses focus after its value was changed, but not commited (e.g., after editing the value of <textarea> or <input type="text">).
... html <input placeholder="enter some text" name="name"/> <p id="log"></p> javascript const input = document.queryselector('input'); const log = document.getelementbyid('log'); input.addeventlistener('change', updatevalue); function updatevalue(e) { log.textcontent = e.target.value; } result specifications specification status html living standardthe definition of 'change' in that specification.
HTMLFormElement.elements - Web APIs
this is a live collection; if form controls are added to or removed from the form, this collection will update to reflect the change.
... var inputs = document.getelementbyid("my-form").elements; // iterate over the form controls for (i = 0; i < inputs.length; i++) { if (inputs[i].nodename === "input" && inputs[i].type === "text") { // update text input inputs[i].value.tolocaleuppercase(); } } disabling form controls var inputs = document.getelementbyid("my-form").elements; // iterate over the form controls for (i = 0; i < inputs.length; i++) { // disable all form controls inputs[i].setattribute("disabled", ""); } specifications specification status comment html living standardthe definition of...
HTMLFormElement - Web APIs
htmlformelement.novalidate a boolean reflecting the value of the form's novalidate html attribute, indicating whether the form should not be validated.
...the following properties have been added: autocomplete, novalidate, and encoding.
HTMLImageElement.height - Web APIs
<p>image height: <span class="size">?</span>px (resize to update)</p> <img src="/files/17373/clock-demo-200px.png" alt="clock" srcset="/files/17373/clock-demo-200px.png 200w, /files/17374/clock-demo-400px.png 400w" sizes="(max-width: 400px) 200px, 300px"> javascript the javascript code looks at the height to determine the height of the image given the width at which it's currently drawn.
... var clockimage = document.queryselector("img"); let output = document.queryselector(".size"); const updateheight = event => { output.innertext = clockimage.height; }; window.addeventlistener("load", updateheight); window.addeventlistener("resize", updateheight); result this example may be easier to try out in its own window.
HTMLImageElement.width - Web APIs
<p>image width: <span class="size">?</span>px (resize to update)</p> <img src="/files/16864/clock-demo-200px.png" alt="clock" srcset="/files/16864/clock-demo-200px.png 200w, /files/16797/clock-demo-400px.png 400w" sizes="(max-width: 400px) 200px, 400px"> javascript the javascript code looks at the width to determine the width of the image at the moment.
... var clockimage = document.queryselector("img"); let output = document.queryselector(".size"); const updatewidth = event => { output.innertext = clockimage.width; }; window.addeventlistener("load", updatewidth); window.addeventlistener("resize", updatewidth); result this example may be easier to try out in its own window.
HTMLImageElement - Web APIs
this specifies a list of candidate images, separated by commas (',', u+002c comma).
... each candidate image is a url followed by a space, followed by a specially-formatted string indicating the size of the image.
HTMLMediaElement - Web APIs
durationchange fired when the duration attribute has been updated.
... timeupdate fired when the time indicated by the currenttime attribute has been updated volumechange fired when the volume has changed.
HTMLTableElement - Web APIs
the htmlcollection is live and is automatically updated when the htmltableelement changes.
...the htmlcollection is live and is automatically updated when the htmltableelement changes.
The HTML DOM API - Web APIs
among the things added to document by the html standard are: support for accessing various information provided by the http headers when loading the page, such as the location from which the document was loaded, cookies, modification date, referring site, and so forth.
... eventsource examples in this example, an <input> element's input event is monitored in order to update the state of a form's "submit" button based on whether or not a given field currently has a value.
Drag Operations - Web APIs
the mouse pointer will update as necessary depending on the value of the dropeffect property.
... however, you can also update the user interface with an insertion point or highlight as needed.
Working with the History API - Web APIs
here too, going back doesn't change the document's contents from what they were in the previous step, although the document might update its contents manually upon receiving the popstate event.
... replacestate() is particularly useful when you want to update the state object or url of the current history entry in response to some user action.
IDBCursor - Web APIs
WebAPIIDBCursor
idbcursor.update() returns an idbrequest object, and, in a separate thread, updates the value at the current position of the cursor in the object store.
... this can be used to update specific records.
IDBIndex - Web APIs
WebAPIIDBIndex
the records in an index are automatically populated whenever records in the referenced object store are inserted, updated, or deleted.
...when the object store changes, all indexes that refers to the object store are automatically updated.
IDBRequest.error - Web APIs
WebAPIIDBRequesterror
example the following example requests a given record title, onsuccess gets the associated record from the idbobjectstore (made available as objectstoretitlerequest.result), updates one property of the record, and then puts the updated record back into the object store.
... var title = "walk dog"; // open up a transaction as usual var objectstore = db.transaction(['todolist'], "readwrite").objectstore('todolist'); // get the do-do list with the specified title var objectstoretitlerequest = objectstore.get(title); objectstoretitlerequest.onsuccess = function() { // grab the data object returned as the result var data = objectstoretitlerequest.result; // update the notified value in the object to "yes" data.notified = "yes"; // create another request that inserts the item // back into the database var updatetitlerequest = objectstore.put(data); // when this new request succeeds, run the displaydata() // function again to update the display updatetitlerequest.onsuccess = function() { displaydata(); }; }; objectstoretitlerequest.one...
IDBRequest.onerror - Web APIs
}; example the following example requests a given record title, onsuccess gets the associated record from the idbobjectstore (made available as objectstoretitlerequest.result), updates one property of the record, and then puts the updated record back into the object store.
...alk dog"; // open up a transaction as usual var objectstore = db.transaction(['todolist'], "readwrite").objectstore('todolist'); // get the to-do list object that has this title as it's title var objectstoretitlerequest = objectstore.get(title); objectstoretitlerequest.onsuccess = function() { // grab the data object returned as the result var data = objectstoretitlerequest.result; // update the notified value in the object to "yes" data.notified = "yes"; // create another request that inserts the item back // into the database var updatetitlerequest = objectstore.put(data); // when this new request succeeds, run the displaydata() // function again to update the display updatetitlerequest.onsuccess = function() { displaydata(); }; }; objectstoretitlerequest.one...
IDBRequest.onsuccess - Web APIs
}; example the following example requests a given record title, onsuccess gets the associated record from the idbobjectstore (made available as objectstoretitlerequest.result), updates one property of the record, and then puts the updated record back into the object store.
...alk dog"; // open up a transaction as usual var objectstore = db.transaction(['todolist'], "readwrite").objectstore('todolist'); // get the to-do list object that has this title as it's title var objectstoretitlerequest = objectstore.get(title); objectstoretitlerequest.onsuccess = function() { // grab the data object returned as the result var data = objectstoretitlerequest.result; // update the notified value in the object to "yes" data.notified = "yes"; // create another request that inserts the item back // into the database var updatetitlerequest = objectstore.put(data); // when this new request succeeds, run the displaydata() // function again to update the display updatetitlerequest.onsuccess = function() { displaydata(); }; }; specifications sp...
IDBRequest.result - Web APIs
WebAPIIDBRequestresult
syntax var myresult = request.result; value any example the following example requests a given record title, onsuccess gets the associated record from the idbobjectstore (made available as objectstoretitlerequest.result), updates one property of the record, and then puts the updated record back into the object store.
...alk dog"; // open up a transaction as usual var objectstore = db.transaction(['todolist'], "readwrite").objectstore('todolist'); // get the to-do list object that has this title as it's title var objectstoretitlerequest = objectstore.get(title); objectstoretitlerequest.onsuccess = function() { // grab the data object returned as the result var data = objectstoretitlerequest.result; // update the notified value in the object to "yes" data.notified = "yes"; // create another request that inserts the item // back into the database var updatetitlerequest = objectstore.put(data); // when this new request succeeds, run the displaydata() // function again to update the display updatetitlerequest.onsuccess = function() { displaydata(); }; }; specifications sp...
IDBVersionChangeRequest.setVersion() - Web APIs
the idbversionchangerequest.setversion method updates the version of the database, returning immediately and running a versionchange transaction on the connected database in a separate thread.
...some not up-to-date browsers still implement this method.
IndexedDB API - Web APIs
you need to specify the database schema, open a connection to your database, and then retrieve and update data within a series of transactions.
...they are still documented in case you need to update previously written code: idbversionchangerequest represents a request to change the version of a database.
install - Web APIs
as with the older startsoftwareupdate method, xpis installed with this method must have their own install.js files in which the full installation is defined.
... in contrast to startsoftwareupdate, install allows you to do multiple installs with the same trigger and provides a unified user experience for the multiple installs.
InstallTrigger - Web APIs
note: this article needs to be updated somewhat.
... startsoftwareupdate triggers the downloading and installation of the software at the specified url.
LinearAccelerationSensor.LinearAccelerationSensor() - Web APIs
specifications specification status comment generic sensor api candidate recommendation defines sensors in general.
... candidate recommendation ...
LinearAccelerationSensor.x - Web APIs
tionsensor({frequency: 60}); lasensor.addeventlistener('reading', e => { console.log("linear acceleration along the x-axis " + lasensor.x); console.log("linear acceleration along the y-axis " + lasensor.y); console.log("linear acceleration along the z-axis " + lasensor.z); }); lasensor.start(); specifications specification status comment generic sensor api candidate recommendation defines sensors in general.
... candidate recommendation ...
LinearAccelerationSensor.y - Web APIs
tionsensor({frequency: 60}); lasensor.addeventlistener('reading', e => { console.log("linear acceleration along the x-axis " + lasensor.x); console.log("linear acceleration along the y-axis " + lasensor.y); console.log("linear acceleration along the z-axis " + lasensor.z); }); lasensor.start(); specifications specification status comment generic sensor api candidate recommendation defines sensors in general.
... candidate recommendation ...
LinearAccelerationSensor.z - Web APIs
tionsensor({frequency: 60}); lasensor.addeventlistener('reading', e => { console.log("linear acceleration along the x-axis " + lasensor.x); console.log("linear acceleration along the y-axis " + lasensor.y); console.log("linear acceleration along the z-axis " + lasensor.z); }); lasensor.start(); specifications specification status comment generic sensor api candidate recommendation defines sensors in general.
... candidate recommendation ...
LinearAccelerationSensor - Web APIs
tionsensor({frequency: 60}); lasensor.addeventlistener('reading', e => { console.log("linear acceleration along the x-axis " + lasensor.x); console.log("linear acceleration along the y-axis " + lasensor.y); console.log("linear acceleration along the z-axis " + lasensor.z); }); lasensor.start(); specifications specification status comment generic sensor api candidate recommendation defines sensors in general.
... candidate recommendation ...
LockedFile.getMetadata() - Web APIs
the following metadata are supported: size : will provide the size of the file lastmodified : will provide the date when the file was last modified return a filerequest object.
...they have the following format: size : a number lastmodified : a date object specifications specification status comment filesystem api editor's draft draft proposal ...
Magnetometer.Magnetometer() - Web APIs
specifications specification status comment generic sensor api candidate recommendation defines sensors in general.
... candidate recommendation ...
Magnetometer.x - Web APIs
WebAPIMagnetometerx
r = new magnetometer({frequency: 60}); magsensor.addeventlistener('reading', e => { console.log("magnetic field along the x-axis " + magsensor.x); console.log("magnetic field along the y-axis " + magsensor.y); console.log("magnetic field along the z-axis " + magsensor.z); }); magsensor.start(); specifications specification status comment generic sensor api candidate recommendation defines sensors in general.
... candidate recommendation ...
Magnetometer.y - Web APIs
WebAPIMagnetometery
r = new magnetometer({frequency: 60}); magsensor.addeventlistener('reading', e => { console.log("magnetic field along the x-axis " + magsensor.x); console.log("magnetic field along the y-axis " + magsensor.y); console.log("magnetic field along the z-axis " + magsensor.z); }); magsensor.start(); specifications specification status comment generic sensor api candidate recommendation defines sensors in general.
... candidate recommendation ...
Magnetometer.z - Web APIs
WebAPIMagnetometerz
r = new magnetometer({frequency: 60}); magsensor.addeventlistener('reading', e => { console.log("magnetic field along the x-axis " + magsensor.x); console.log("magnetic field along the y-axis " + magsensor.y); console.log("magnetic field along the z-axis " + magsensor.z); }); magsensor.start(); specifications specification status comment generic sensor api candidate recommendation defines sensors in general.
... candidate recommendation ...
Magnetometer - Web APIs
r = new magnetometer({frequency: 60}); magsensor.addeventlistener('reading', e => { console.log("magnetic field along the x-axis " + magsensor.x); console.log("magnetic field along the y-axis " + magsensor.y); console.log("magnetic field along the z-axis " + magsensor.z); }); magsensor.start(); specifications specification status comment generic sensor api candidate recommendation defines sensors in general.
... candidate recommendation ...
MediaDevices: devicechange event - Web APIs
bubbles no cancelable no interface event event handler ondevicechange example you can use the devicechange event in an addeventlistener method: navigator.mediadevices.addeventlistener('devicechange', function(event) { updatedevicelist(); }); or use the ondevicechange event handler property: navigator.mediadevices.ondevicechange = function(event) { updatedevicelist(); } specifications specification status media capture and streamsthe definition of 'devicechange' in that specification.
... candidate recommendation ...
MediaDevices.getUserMedia() - Web APIs
overconstrainederror the specified constraints resulted in no candidate devices which met the criteria requested.
... candidate recommendation initial definition ...
MediaElementAudioSourceNode - Web APIs
when the mouse pointer is moved, the updatepage() function is invoked, which calculates the current gain as a ratio of mouse y position divided by overall window height.
...ourcenode // feed the htmlmediaelement into it var source = audioctx.createmediaelementsource(myaudio); // create a gain node var gainnode = audioctx.creategain(); // create variables to store mouse pointer y coordinate // and height of screen var cury; var height = window.innerheight; // get new mouse pointer coordinates when mouse is moved // then set new gain value document.onmousemove = updatepage; function updatepage(e) { cury = (window.event) ?
MediaSession.setPositionState() - Web APIs
the mediasession method setpositionstate() is used to update the current document's media playback position and speed for presentation by user's device in any kind of interface that provides details about ongoing media.
... syntax navigator.mediasession.setpositionstate(statedict); parameters statedict optional an object conforming to the mediapositionstate dictionary, providing updated information about the playback position and speed of the document's ongoing media.
MediaSource.duration - Web APIs
invalidstateerror mediasource.readystate is not equal to open, or one or more of the sourcebuffer objects in mediasource.sourcebuffers are being updated (i.e.
... example the following snippet is based on a simple example written by nick desaulniers (view the full demo live, or download the source for further investigation.) function sourceopen (_) { //console.log(this.readystate); // open var mediasource = this; var sourcebuffer = mediasource.addsourcebuffer(mimecodec); fetchab(asseturl, function (buf) { sourcebuffer.addeventlistener('updateend', function (_) { mediasource.endofstream(); mediasource.duration = 120; video.play(); //console.log(mediasource.readystate); // ended }); sourcebuffer.appendbuffer(buf); }); }; ...
MediaSource.endOfStream() - Web APIs
return value undefined exceptions exception explanation invalidstateerror mediasource.readystate is not equal to open, or one or more of the sourcebuffer objects in mediasource.sourcebuffers are being updated (i.e.
... = url.createobjecturl(mediasource); mediasource.addeventlistener('sourceopen', sourceopen); } else { console.error('unsupported mime type or codec: ', mimecodec); } function sourceopen (_) { //console.log(this.readystate); // open var mediasource = this; var sourcebuffer = mediasource.addsourcebuffer(mimecodec); fetchab(asseturl, function (buf) { sourcebuffer.addeventlistener('updateend', function (_) { mediasource.endofstream(); video.play(); //console.log(mediasource.readystate); // ended }); sourcebuffer.appendbuffer(buf); }); }; specifications specification status comment media source extensionsthe definition of 'endofstream()' in that specification.
active - Web APIs
when that stream becomes available (that is, when the returned promise is fulfilled, a button on the page is updated based on whether or not the stream is currently active.
... candidate recommendation initial definition.
MediaStreamTrack.enabled - Web APIs
usage notes if the mediastreamtrack represents the video input from a camera, disabling the track by setting enabled to false also updates device activity indicators to show that the camera is not currently recording or streaming.
... candidate recommendation initial specification.
MediaStreamTrack.getConstraints() - Web APIs
example this example obtains the current constraints for a track, sets the facingmode, and applies the updated constraints.
... candidate recommendation initial definition.
MediaStreamTrack - Web APIs
candidate recommendation additional properties for isolated track support media capture and streamsthe definition of 'mediastreamtrack' in that specification.
... candidate recommendation initial definition ...
MediaTrackConstraints.deviceId - Web APIs
however, the value of the deviceid is determined by the source of the track's content, and there's no particular format mandated by the specification (although some kind of guid is recommended).
... candidate recommendation initial specification.
MediaTrackConstraints.groupId - Web APIs
however, the value of the groupid is determined by the source of the track's content, and there's no particular format mandated by the specification (although some kind of guid is recommended).
... candidate recommendation initial specification.
MerchantValidationEvent() - Web APIs
validationurl optional the url from which to retrieve payment handler specific verification information used to validate the merchant.
... candidate recommendation initial definition.
MerchantValidationEvent.validationURL - Web APIs
the merchantvalidationevent property validationurl is a read-only string value providing the url from which to fetch the payment handler-specific data needed to validate the merchant.
... candidate recommendation initial definition.
Metadata - Web APIs
WebAPIMetadata
this metadata includes the file's size and modification date and time.
... properties modificationtime read only a date object indicating the date and time the entry was modified.
Using Navigation Timing - Web APIs
for example, to measure the perceived loading time for a page: window.addeventlistener("load", function() { let now = new date().gettime(); let loadingtime = now - performance.timing.navigationstart; document.queryselector(".output").innertext = loadingtime + " ms"; }, false); this code, executed when the load event occurs, subtracts from the current time the time at which the navigation whose timing was recorded began (performance.timing.navigationstart), and outputs that information to the screen by inse...
...the new code looks like this: window.addeventlistener("load", function() { let now = new date().gettime(); let loadingtime = now - performance.timing.navigationstart; output = "load time: " + loadingtime + " ms<br/>"; output += "navigation type: "; switch(performance.navigation.type) { case performancenavigation.type_navigate: output += "navigation"; break; case performancenavigation.type_reload: output += "reload"; break; case performan...
Navigator.registerProtocolHandler() - Web APIs
syntax navigator.registerprotocolhandler(scheme, url, title); note: recently updated to navigator.registerprotocolhandler(scheme, url), but no browsers currently support this version.
...it is recommended to always set the title, since browsers that support the updated spec most likely will be backwards-compatible and still accept the title (but not use it).
Navigator.onLine - Web APIs
the property sends updates whenever the browser's ability to connect to the network changes.
... the update occurs when the user follows links or when a script requests a remote page.
PayerErrors.email - Web APIs
WebAPIPayerErrorsemail
example function validatepayment(response) { const correctionpromises let paymenterrors = {}; let payererrors = {}; // check payer details if (!validemail(response.payeremail)) { payererrors.email = "please make sure you enter a valid email address." } if (!validname(response.payername)) { payererrors.email = "please enter a valid name, using only <appropriate characters>." } if (!validphone(re...
... candidate recommendation initial definition.
PaymentAddress.country - Web APIs
syntax var paymentcountry = paymentaddress.country; value a domstring which contains the iso3166-1 alpha-2 code identifying the country in which the address is located, or an empty string if no country is available, which frequently can be assumed to mean "same country as the site owner." usage notes if the payment handler validates the address and determines that the value of country is invalid, a call to paymentrequestupdateevent.updatewith() will be made with a details object containing a shippingaddresserrors field.
... candidate recommendation initial definition.
PaymentCurrencyAmount.value - Web APIs
see the example verifying a properly formatted price below for a simple regular expression that can be used to validate the value string prior to submission.
... candidate recommendation ...
PaymentMethodChangeEvent.methodDetails - Web APIs
ev.updatewith(newstuff); }; const response = await request.show(); note that the methoddetails property is being used by the calculatediscount() function to compute any payment discount, then updatewith() is called to update the event with the computed update.
... candidate recommendation initial definition.
PaymentMethodChangeEvent.methodName - Web APIs
ev.updatewith(newstuff); }; const response = await request.show(); specifications specification status comment payment request apithe definition of 'paymentmethodchangeevent.methodname' in that specification.
... candidate recommendation initial definition.
PaymentRequest.onpaymentmethodchange - Web APIs
ev.updatewith(newstuff); }; const response = await request.show(); specifications specification status comment payment request apithe definition of 'onpaymentmethodchange' in that specification.
... candidate recommendation initial definition.
PaymentRequest - Web APIs
events merchantvalidation secure context with some payment handlers (e.g., apple pay), this event handler is called to handle the merchantvalidation event, which is dispatched when the user agent requires that the merchant validate that the merchant or vendor requesting payment is legitimate.
... candidate recommendation initial definition.
PaymentResponse - Web APIs
allows the developer to revalidate any requested user data (e.g., the phone number or the email address) if it changes.
... candidate recommendation initial definition.
Performance - Web APIs
candidate recommendation changes getentries() interface.
... candidate recommendation defines clearresourcetimings() and setresourcetimingbuffersize() methods and the onresourcetimingbufferfull property.
PerformanceEntry - Web APIs
" + properties[i] + " is not supported"); } } } specifications specification status comment resource timing level 3 editor's draft resource timing level 2 working draft resource timing level 1 candidate recommendation adds the performanceresourcetiming interface and the resource value for entrytype.
... candidate recommendation added tojson() serializer method.
Performance API - Web APIs
as such, the performance api defines a domhighrestimestamp type rather than using the date.now() interface.
... performance timeline level 2 candidate recommendation adds serializer to the performanceentry interface as well as adding the performanceobserver interface and callback resource timing level 1 candidate recommendation adds the performanceresourcetiming interface.
PointerEvent - Web APIs
pointerrawupdate this event is fired when any of a pointer's properties change.
... editor's draft added the getcoalescedevents() and getpredictedevents() methods and pointerrawupdate event.
Using Pointer Events - Web APIs
its responsibility in this example is to update the cached touch information and to draw a line from the previous position to the current position of each touch.
... // and a square at the end ongoingtouches.splice(idx, 1); // remove it; we're done } else { log("can't figure out which touch to end"); } } this is very similar to the previous function; the only real differences are that we draw a small square to mark the end and that when we call array.splice(), we simply remove the old entry from the ongoing touch list, without adding in the updated information.
Pointer events - Web APIs
the target element (node) should be large enough to accommodate the largest contact surface area (typically a finger touch).
... specifications specification status comment pointer events – level 3 editor's draft added new apis for getcoalescedevent and getpredictedevents, new pointerrawupdate event, additional touch-action property values pan-left, pan-right, pan-up, pan-down.
Push API - Web APIs
WebAPIPush API
this lets developers deliver asynchronous notifications and updates to users that opt in, resulting in better engagement with timely new content.
... serviceworkerglobalscope.onpushsubscriptionchange an event handler fired whenever a pushsubscriptionchange event occurs; for example, when a push subscription has been invalidated, or is about to be invalidated (e.g.
RTCCertificate - Web APIs
properties rtccertificate.expires read only returns the expiration date of the certificate.
... specifications specification status comment webrtc 1.0: real-time communication between browsers candidate recommendation initial definition.
RTCDTMFSender: tonechange event - Web APIs
examples this example establishes a handler for the tonechange event which updates an element to display the currently playing tone in its content, or, if all tones have played, the string "<none>".
... candidate recommendation definition for the webrtc api ...
RTCDTMFToneChangeEvent.tone - Web APIs
syntax var tone = dtmftonechangeevent.tone; example this example establishes a handler for the tonechange event which updates an element to display the currently playing tone in its content, or, if all tones have played, the string "<none>".
... candidate recommendation initial specification.
RTCDataChannel: close event - Web APIs
bubbles no cancelable no interface event event handler property rtcdatachannel.onclose examples this example sets up a handler for the close event for the rtcdatachannel named dc; its responsibility in this example is to update user interface elements to reflect that there is no longer an ongoing call, and to allow a new call to be started.
... candidate recommendation initial specification.
RTCDataChannel.id - Web APIs
WebAPIRTCDataChannelid
code that uses that property needs to be updated.
... candidate recommendation initial specification.
RTCDataChannel.onopen - Web APIs
it then establishes an open event handler which updates some user interface elements to prepare them for being used to send messages over the data channel.
... candidate recommendation initial specification.
RTCDataChannel.send() - Web APIs
var pc = new rtcpeerconnection(); var dc = pc.createdatachannel("backchannel"); function sendmessage(msg) { let obj = { "message": msg, "timestamp": new date() } dc.send(json.stringify(obj)); } specifications specification status comment webrtc 1.0: real-time communication between browsersthe definition of 'rtcdatachannel.send()' in that specification.
... candidate recommendation initial specification.
RTCDtlsTransport.state - Web APIs
failed the transport has failed as the result of an error (such as receipt of an error alert or failure to validate the remote fingerprint).
... candidate recommendation initial definition.
RTCDtlsTransport - Web APIs
if your code accesses rtcrtpsenders and/or rtcrtpreceivers directly, you may encounter situations where they're initially separate, then half or more of them get closed and the senders and receivers updated to refer to the appropriate remaining rtcdtlstransport objects.
... candidate recommendation initial definition.
RTCErrorEvent - Web APIs
the most common of these is probably rtcpeerconnectioniceerrorevent, used by the icecandidateerror event, which signals an error that has occurred while gathering ice candidates during connection negotiation.
... candidate recommendation initial definition.
RTCIceParameters.usernameFragment - Web APIs
see rtcicecandidate.usernamefragment to learn more about username fragments and their role in a connection.
... candidate recommendation initial specification.
RTCIceParameters - Web APIs
see rtcicecandidate.usernamefragment for further information.
... candidate recommendation initial specification.
RTCIceRole - Web APIs
you can learn more about ice roles in choosing a candidate pair in webrtc connectivity.
... candidate recommendation initial definition.
RTCIceTransport.component - Web APIs
an rtcicecomponent of this value corresponds to the component id field in the candidate a-line with the value 1.
... candidate recommendation initial definition.
RTCIceTransport.role - Web APIs
you can learn more about ice roles in choosing a candidate pair in webrtc connectivity.
... candidate recommendation initial definition.
RTCIceTransport: statechange event - Web APIs
the state can be used to determine how far through the process of examining, verifying, and selecting a valid candidate pair is prior to successfully connecting the two peers for webrtc communications.
... candidate recommendation ...
RTCInboundRtpStreamStats.qpSum - Web APIs
the qpsum property of the rtcinboundrtpstreamstats dictionary is a value generated by adding the quantization parameter (qp) values for every frame sent or received to date on the video track corresponding to this rtcinboundrtpstreamstats object.
... candidate recommendation initial definition.
RTCNetworkType - Web APIs
this type is used as the value or the following properties: rtcicecandidate's networktype rtcstunserverconnectionstats's networktype values bluetooth a bluetooth connection is used by the described connection.
... candidate recommendation initial definition.
RTCOutboundRtpStreamStats.qpSum - Web APIs
the qpsum property of the rtcoutboundrtpstreamstats dictionary is a value generated by adding the quantization parameter (qp) values for every frame this sender has produced to date on the video track corresponding to this rtcoutboundrtpstreamstats object.
... candidate recommendation initial definition.
RTCPeerConnection.addStream() - Web APIs
navigator.mediadevices.getusermedia({video:true, audio:true}, function(stream) { var pc = new rtcpeerconnection(); pc.addstream(stream); }); migrating to addtrack() compatibility allowing, you should update your code to instead use the addtrack() method: navigator.getusermedia({video:true, audio:true}, function(stream) { var pc = new rtcpeerconnection(); stream.gettracks().foreach(function(track) { pc.addtrack(track, stream); }); }); the newer addtrack() api avoids confusion over whether later changes to the track-makeup of a stream affects a peer connection (they do not).
... candidate recommendation initial specification.
RTCPeerConnection.addTrack() - Web APIs
the associated rtcrtptransceiver has its currentdirection updated to include sending; if its current value is "recvonly", it becomes "sendrecv", and if its current value is "inactive", it becomes "sendonly".
... candidate recommendation initial specification.
RTCPeerConnection: connectionstatechange event - Web APIs
it simply calls an app-defined function called setonlinestatus() to update a status display.
... candidate recommendation initial specification.
RTCPeerConnection.createDataChannel() - Web APIs
this can be useful for back-channel content such as images, file transfer, text chat, game update packets, and so forth.
... candidate recommendation initial definition.
RTCPeerConnection.currentLocalDescription - Web APIs
also included is a list of any ice candidates that may already have been generated by the ice agent since the offer or answer represented by the description was first instantiated.
... candidate recommendation initial specification.
RTCPeerConnection.currentRemoteDescription - Web APIs
also included is a list of any ice candidates that may already have been generated by the ice agent since the offer or answer represented by the description was first instantiated.
... candidate recommendation initial specification.
RTCPeerConnection.getStats() - Web APIs
this form of getstats() has been or will soon be removed from most browsers; you should not use it, and should update existing code to use the new promise-based version.
... candidate recommendation initial definition.
RTCPeerConnection: identityresult event - Web APIs
instead, the peeridentity property returns a promise that resolves with an identity or rejects if an error occurs or if unable to validate the identity.
... candidate recommendation ...
RTCPeerConnection: negotiationneeded event - Web APIs
this starts the process of ice negotiation by instructing your code to begin exchanging ice candidates through the signaling server.
... candidate recommendation ...
RTCPeerConnection.setLocalDescription() - Web APIs
you should update any existing code to use the promise-based version of setlocaldescription() instead.
... candidate recommendation initial specification.
RTCPeerConnection.setRemoteDescription() - Web APIs
you should update any existing code to use the promise-based version of setremotedescription() instead.
... candidate recommendation initial specification.
RTCPeerConnection: idpvalidationerror event - Web APIs
an idpvalidationerror event informs the target, a rtcpeerconnection object, that the identity provider (idp) encountered an error when trying to validate an identity assertion.
... candidate recommendation initial definition.
RTCRemoteOutboundRtpStreamStats.localId - Web APIs
the remainder of the networkteststop() function constructs the html used to display the output of the collected and computed results to the user, then append it to the element statsbox, which we're using to show the status updates to the user.
... candidate recommendation initial definition.
RTCRtpReceiver.getStats() - Web APIs
example this simple example obtains the statistics for an rtcrtpreceiver and updates an element's innertext to display the number of packets lost.
... candidate recommendation initial specification.
RTCRtpSender.getStats() - Web APIs
example this simple example obtains the statistics for an rtcrtpsender and updates an element's innertext to display the current round trip time for requests on the sender.
... candidate recommendation initial specification.
RTCRtpStreamStats.firCount - Web APIs
candidate recommendation initial definition.
... candidate recommendation initial definition.
RTCRtpStreamStats.nackCount - Web APIs
candidate recommendation initial definition.
... candidate recommendation initial definition.
RTCRtpStreamStats.pliCount - Web APIs
candidate recommendation initial definition.
... candidate recommendation initial definition.
RTCRtpStreamStats.sliCount - Web APIs
candidate recommendation initial definition.
... candidate recommendation initial definition.
RTCRtpStreamStats.ssrc - Web APIs
the manner in which these values are generated is not mandated by the specification, although it does make recommendations.
... candidate recommendation initial definition.
RTCRtpTransceiver.stopped - Web APIs
note: currently only firefox implements stopped, and has not yet been updated to implement this change.
... candidate recommendation ...
RTCSessionDescription - Web APIs
f (!pc) start(false); var message = json.parse(evt.data); if (message.sdp) pc.setremotedescription(new rtcsessiondescription(message), function () { // if we received an offer, we need to answer if (pc.remotedescription.type == "offer") pc.createanswer(localdesccreated, logerror); }, logerror); else pc.addicecandidate(new rtcicecandidate(message.candidate), function () {}, logerror); }; specifications specification status comment webrtc 1.0: real-time communication between browsersthe definition of 'rtcsessiondescription' in that specification.
... candidate recommendation initial definition.
SVGGraphicsElement: cut event - Web APIs
note though that cancelling the default action will also prevent the document from being updated.
... specifications specification status comment scalable vector graphics (svg) 2 candidate recommendation definition that the clipboard events apply to svg elements.
SourceBuffer.abort() - Web APIs
for example, consider this code: sourcebuffer.addeventlistener('updateend', function (_) { ...
... }); sourcebuffer.appendbuffer(buf); let's say that after the call to appendbuffer but before the updateend event fires (i.e.
Storage.setItem() - Web APIs
WebAPIStoragesetItem
the setitem() method of the storage interface, when passed a key name and value, will add that key to the given storage object, or update that key's value if it already exists.
... syntax storage.setitem(keyname, keyvalue); parameters keyname a domstring containing the name of the key you want to create/update.
Storage - Web APIs
WebAPIStorage
storage.setitem() when passed a key name and value, will add that key to the storage, or update that key's value if it already exists.
...if it does, we run a function called setstyles() that grabs the data items using storage.getitem() and uses those values to update page styles.
SubtleCrypto.exportKey() - Web APIs
/* convert an arraybuffer into a string from https://developers.google.com/web/updates/2012/06/how-to-convert-arraybuffer-to-and-from-string */ function ab2str(buf) { return string.fromcharcode.apply(null, new uint8array(buf)); } /* export the given key and write it into the "exported-key" space.
... /* convert an arraybuffer into a string from https://developers.google.com/web/updates/2012/06/how-to-convert-arraybuffer-to-and-from-string */ function ab2str(buf) { return string.fromcharcode.apply(null, new uint8array(buf)); } /* export the given key and write it into the "exported-key" space.
SubtleCrypto.importKey() - Web APIs
/* convert a string into an arraybuffer from https://developers.google.com/web/updates/2012/06/how-to-convert-arraybuffer-to-and-from-string */ function str2ab(str) { const buf = new arraybuffer(str.length); const bufview = new uint8array(buf); for (let i = 0, strlen = str.length; i < strlen; i++) { bufview[i] = str.charcodeat(i); } return buf; } const pemencodedkey = `-----begin private key----- miievqibadanbgkqhkig9w0baqefaascbkcwggsjageaaoibaqdd0tpv/du2vftjvxj1t/...
... // from https://developers.google.com/web/updates/2012/06/how-to-convert-arraybuffer-to-and-from-string function str2ab(str) { const buf = new arraybuffer(str.length); const bufview = new uint8array(buf); for (let i = 0, strlen = str.length; i < strlen; i++) { bufview[i] = str.charcodeat(i); } return buf; } const pemencodedkey = `-----begin public key----- miibijanbgkqhkig9w0baqefaaocaq8amiibcgkcaqeay3xo3u13dc+x...
TextTrackList - Web APIs
to keep it up to date, handlers for the addtrack and removetrack events are set up.
... texttracks.onaddtrack = updatetrackcount; texttracks.onremovetrack = updatetrackcount; function updatetrackcount(event) { trackcount = texttracks.length; drawtrackcountindicator(trackcount); } specifications specification status comment html living standardthe definition of 'textracklist' in that specification.
Touch events - Web APIs
its responsibility in this example is to update the cached touch information and to draw a line from the previous position to the current position of each touch.
... the end ongoingtouches.splice(idx, 1); // remove it; we're done } else { console.log("can't figure out which touch to end"); } } } this is very similar to the previous function; the only real differences are that we draw a small square to mark the end and that when we call array.splice(), we simply remove the old entry from the ongoing touch list, without adding in the updated information.
VideoTrackList.onchange - Web APIs
example this snippet establishes a handler for the change event that looks at each of the tracks in the list, calling a function to update the state of a user interface control that indicates the current state of the track.
... var tracklist = document.queryselector("video").videotracks; tracklist.onchange = function(event) { tracklist.foreach(function(track) { updatetrackselectedbutton(track.id, track.selected); }); }; the updatetrackselectedbutton(), in this example, should be a function that finds a user interface control using the track's id (perhaps the app uses the track id as the control element's id) and the track's selected flag to determine which state the control should be in now.
VideoTrackList - Web APIs
to keep it up to date, handlers for the addtrack and removetrack events are set up.
... videotracks.onaddtrack = updatetrackcount; videotracks.onremovetrack = updatetrackcount; function updatetrackcount(event) { trackcount = videotracks.length; drawtrackcountindicator(trackcount); } specifications specification status comment html living standardthe definition of 'videotracklist' in that specification.
WebGLRenderingContext.disable() - Web APIs
gl.depth_test deactivates depth comparisons and updates to the depth buffer.
... gl.stencil_test deactivates stencil testing and updates to the stencil buffer.
WebGLRenderingContext.enable() - Web APIs
gl.depth_test activates depth comparisons and updates to the depth buffer.
... gl.stencil_test activates stencil testing and updates to the stencil buffer.
A basic 2D WebGL animation example - Web APIs
that's done here by calling requestanimationframe(), which asks that a callback function be executed the next time the browser is ready to update the screen.
...then the value of previoustime is updated and we call animatescene() to draw the next frame (and in turn schedule the next frame to be drawn, ad infinitum).
Matrix math for the web - Web APIs
the focus in the glmatrix library is to have target arrays that are allocated before the update loop.
... <div id='move-me' class='transformable'> <h2>move me with a matrix</h2> <p>lorem ipsum dolor sit amet, consectetur adipisicing elit...</p> </div> finally, for each of the examples we will generate a 4x4 matrix, then update the <div>'s style to have a transform applied to it, set to a matrix3d.
Writing WebSocket client applications - Web APIs
var msg = { type: "message", text: document.getelementbyid("text").value, id: clientid, date: date.now() }; // send the msg object as a json-formatted string.
...there are assorted types of data packets the client might receive, such as: login handshake message text user list updates the code that interprets these incoming messages might look like this: examplesocket.onmessage = function(event) { var f = document.getelementbyid("chatbox").contentdocument; var text = ""; var msg = json.parse(event.data); var time = new date(msg.date); var timestr = time.tolocaletimestring(); switch(msg.type) { case "id": clientid = msg.id; setusername(); ...
Using bounded reference spaces - Web APIs
; let spacetype = null; function onsessionstarted(session) { xrsession = session; spacetype = "bounded-floor"; xrsession.requestreferencespace(spacetype) .then(onrefspacecreated) .catch(() => { spacetype = "local-floor"; xrsession.requestreferencespace(spacetype) .then(onrefspacecreated) .catch(handleerror); }); } function onrefspacecreated(refspace) { xrsession.updaterenderstate({ baselayer: new xrwebgllayer(xrsession, gl) }); // now set up matrices, create a secondary reference space to // transform the viewer's pose, and so forth.
... this would change the onrefspacecreated() method from the above snippet to: function onrefspacecreated(refspace) { xrsession.updaterenderstate({ baselayer: new xrwebgllayer(xrsession, gl) }); let startposition = vec3.fromvalues(0, 1.5, 0); const startorientation = vec3.fromvalues(0, 0, 1.0); xrreferencespace = xrreferencespace.getoffsetreferencespace( new xrrigidtransform(startposition, startorientation)); xrsession.requestanimationframe(ondrawframe); } in this code, executed after the reference sp...
Lighting a WebXR setting - Web APIs
once the api has stabilized, we'll update this documentation with the details.
... the lighting estimation api specification mandates that all user agents perform temporal and spatial filtering to fuzz the data in a manner that reduces its usefulness for the purpose of locating the user or performing side-channel attacks.
Web Animations API Concepts - Web APIs
the internet explorer team requested an animations api to consolidate and normalize animation functionality across all browsers, and thus efforts began in earnest among mozilla firefox and google chrome developers to create the one animation spec to rule them all: the web animations api.
...(read more about how to use element.animate() in using the web animations api.) uses the api allows for the creation of dynamic animations that can be updated on the fly as well as more straightforward, declarative animations like those css creates.
Migrating from webkitAudioContext - Web APIs
in this article, we cover the differences in web audio api since it was first implemented in webkit and how to update your code to use the modern web audio api.
... (audiobuffersourcenode has yet another way of starting output: the notegrainon() method.) the noteon()/notegrainon()/noteoff() methods were the original way to start/stop output in these nodes, and in the newer versions of the specification, the noteon() and notegrainon() methods were consolidated into a single start() method, and the noteoff() method was renamed to the stop() method.
Using the Web Speech API - Web APIs
e demo, so we are just specifying one (which is actually the default anyway.) recognition.grammars = speechrecognitionlist; recognition.continuous = false; recognition.lang = 'en-us'; recognition.interimresults = false; recognition.maxalternatives = 1; starting the speech recognition after grabbing references to the output <div> and the html element (so we can output diagnostic messages and update the app background color later on), we implement an onclick handler so that when the screen is tapped/clicked, the speech recognition service will start.
... inputtxt.blur(); } updating the displayed pitch and rate values the last part of the code simply updates the pitch/rate values displayed in the ui, each time the slider positions are moved.
Using Web Workers - Web APIs
they are intended to (amongst other things) enable the creation of effective offline experiences, intercepting network requests and taking appropriate action based on whether the network is available and updated assets reside on the server.
... functions and interfaces available in workers you can use most standard javascript features inside a web worker, including: navigator xmlhttprequest array, date, math, and string windowtimers.settimeout and windowtimers.setinterval the main thing you can't do in a worker is directly affect the parent page.
window.cancelAnimationFrame() - Web APIs
other browsers can use something like date.now().
... var myreq; function step(timestamp) { var progress = timestamp - start; d.style.left = math.min(progress / 10, 200) + 'px'; if (progress < 2000) { // it's important to update the requestid each time you're calling requestanimationframe myreq = requestanimationframe(step); } } myreq = requestanimationframe(step); // the cancelation uses the last requestid cancelanimationframe(myreq); specifications specification status comment html living standardthe definition of 'cancelanimationframe()' in that specification.
XRReferenceSpace.getOffsetReferenceSpace() - Web APIs
canvas.oncontextmenu = (event) => { event.preventdefault(); }; canvas.addeventlistener("mousemove", (event) => { if (event.buttons & 2) { rotateviewby(event.movementx, event.movementy); } }); next, the rotateviewby() function, which updates the mouse look direction's yaw and pitch based on the mouse delta values from the mousemove event.
...each time this is called, the new offsets are used to update the current values of mousepitch and mouseyaw.
XRReferenceSpace: reset event - Web APIs
the event is sent before any animation frame callbacks are executed to render the pending frame, to ensure that those callbacks have the updated coordinate system available.
...instead of allowing this to happen, you can integrate the emulatedposition into the teleportation offset calculated prior to calling getoffsetreferencespace() to create a new reference space whose updated effective origin is adjusted by the distance the viewer's position jumped since the previous frame.
XRRenderStateInit - Web APIs
the xrrenderstateinit dictionary is a writeable version of the xrrenderstate interface, and is used when calling an xrsession's updaterenderstate() method to apply changes to the render state prior to rendering the next frame.
... usage notes any properties not specified in the xrrenderstateinit compliant object passed into updaterenderstate() are left at their current values.
XRSessionInit - Web APIs
at this time, all features are identified using strings from the xrreferencespacetype enumeration, but future updates to the webxr standard may add more features.
...more features may be added in future updates to the webxr standard.
XRWebGLLayer.getNativeFramebufferScaleFactor() static method - Web APIs
frame buffer at the device's native resolution, regardless of any performance concerns: function requestnativescalewebgllayer(gl, xrsession) { return gl.makexrcompatible().then(() => { let scalefactor = xrwebgllayer.getnativeframebufferscalefactor(xrsession); let gllayer = new xrwebgllayer(xrsession, gl, { framebufferscalefactor: scalefactor }); xrsession.updaterenderstate({ baselayer: gllayer }); }); }; this starts by calling the webgl rendering context function makexrcompatible().
... that gets us a new xrwebgllayer object representing a rendering surface we can use for the xrsession; we set it as the rendering surface for xrsession by calling its updaterenderstate() method, passing the new gllayer in using the xrrenderstate dictionary's xrrenderstate.baselayer property.
XSL Transformations in Mozilla FAQ - Web APIs
ie up to version 6 required a deprecated namespace of a xslt working draft, please update to mozilla ;-), ie6+ or msxml3+, as it is fixed there.
... original document information author(s): axel hecht last updated date: february 2, 2005 copyright information: portions of this content are © 1998–2006 by individual mozilla.org contributors; content available under a creative commons license ...
Using the aria-invalid attribute - Accessibility
<input name="name" id="name" aria-required="true" aria-invalid="false" onblur="checkvalidity('name', ' ', 'invalid name entered (requires both first and last name)');"/> <br /> <input name="email" id="email" aria-required="true" aria-invalid="false" onblur="checkvalidity('email', '@', 'invalid e-mail address');"/> note that it is not necessary to validate the fields immediately on blur; the application could wait until the form is submitted (though this is not necessarily recommended).
...shows a very simple validation function, which only checks for the presence of a particular character (in the real world, validation will likely be more sophisticated): function checkvalidity(aid, asearchterm, amsg){ var elem = document.getelementbyid(aid); var invalid = (elem.value.indexof(asearchterm) < 0); if (invalid) { elem.setattribute("aria-invalid", "true"); updatealert(amsg); } else { elem.setattribute("aria-invalid", "false"); updatealert(); } } the snippet below shows the alert functions, which add (or remove) the error message: function updatealert(msg) { var oldalert = document.getelementbyid("alert"); if (oldalert) { document.body.removechild(oldalert); } if (msg) { var newalert = document.cre...
Using the progressbar role - Accessibility
as the task progresses, the aria-valuenow value has to be updated dynamically to indicate this progress to assistive technology products.
... possible effects on user agents and assistive technology screen readers should announce the progress updates as they occur.
ARIA: dialog role - Accessibility
<div role="dialog" aria-labelledby="dialog1title" aria-describedby="dialog1desc"> <h2 id="dialog1title">your personal details were successfully updated</h2> <p id="dialog1desc">you can change your details at any time in the user account section.</p> <button>close</button> </div> description marking up a dialog element with the dialog role helps assistive technology identify the dialog's content as being grouped and separated from the rest of the page content.
...this approach is shown in the code snippet below: <div role="dialog" aria-labelledby="dialog1title" aria-describedby="dialog1desc"> <h2 id="dialog1title">your personal details were successfully updated</h2> <p id="dialog1desc">you can change your details at any time in the user account section.</p> <button>close</button> </div> keep in mind that a dialog's title and description text do not have to be focusable in order to be perceived by screen readers operating in a non-virtual mode.
ARIA: listbox role - Accessibility
update the aria-activedescendant value on the listbox to the id of the newly selected option visually handle the blur, focus, and selected states of the option toggling the state of an option in a multi select listbox when the user clicks on an option, hits space when focused on an option, or otherwise toggles the state of an option, the following must occur: toggle the aria-selected state of the...
... change the appearance of the option to reflect it's selected state update the aria-activedescendant value on the listbox to the id of the option the user just interacted with, even if they toggled the option to be unselected.
WAI-ARIA Roles - Accessibility
for a full list of roles, see using aria: roles, states, and properties aria: alert rolethe alert role can be used to tell the user an element has been dynamically updated.
... screen readers will instantly start reading out the updated content when the role is added.
Basic form hints - Accessibility
the second part of the example, a snippet of javascript validates the email format, and sets the aria-invalid attribute of the email field (line 12 of the html) according to the result (in addition to changing the presentation of the element).
... <label for="name">* name:</label> <input type="text" value="name" id="name" aria-required="true"/> </div> <div> <label for="phone">phone:</label> <input type="text" value="phone" id="phone" aria-required="false"/> </div> <div> <label for="email">* e-mail:</label> <input type="text" value="email" id="email" aria-required="true"/> </div> </form> the script that validates the form entry would look something like this: var validate = function () { var emailelement = document.getelementbyid(emailfieldid); var valid = emailvalid(formdata.email); // returns true if valid, false otherwise emailelement.setattribute("aria-invalid", !valid); setelementbordercolour(emailelement, valid); // sets the border to red if second arg is false }; providing helpful erro...
Accessibility: What users can do to browse more safely - Accessibility
those in the public sector who must accomodate those with special sensitivities, should consider setting aside at least one work station and becoming familiar with its personalization and accessibility settings.
...one work station can be set up to acommodate both a low-vision individual (needs high-contrast) and to accomodate an individual with photosensitive susceptibilities, by simply, adjusting personalization and accessiblity settings.
Keyboard-navigable JavaScript widgets - Accessibility
to do this: bind a key down handler to each element in the group, and when an arrow key is used to move to another element: programmatically apply focus to the new element, update the tabindex of the focused element to "0", and update the tabindex of the previously focused element to "-1".
...for example, the code that updates the tabindex or the styling when users navigate using the arrow keys should also be used by mouse click handlers to produce the same changes.
Web Accessibility: Understanding Colors and Luminance - Accessibility
luckily, css media queries level 5 will be a game-changer in accessibility initiatives, because it will allow users to select settings that accomodate their needs best.
...macknik on november 1, 2014 scientific papers photic- and pattern-induced seizures: expert consensus of the epilepsy foundation of america working group w3c issues and discussions contrast ratio math and related visual issues #695 luminance / luma confusion #236 outdated threshold for srgb companding in the "relative luminance" definition #308 non-srgb color spaces, outdated srgb threshold, and other issues in the "relative luminance" definition #360 w3c resources css color module level 3 css color module level 4 ensuring that a contrast ratio of 3:1 is provided for icons understanding success criterion 1.4.3: contrast (minimum) wcag working group's wi...
Operable - Accessibility
live multiplayer games), and any other activity that requires a time limit and would be invalidated if it were turned off.
... for auto-updating information that starts automatically and is shown alongside other content, controls should be provided to pause, stop, or hide it, or to control the frequency of updates.
Text labels and names - Accessibility
<div role="dialog" aria-labelledby="dialog1title" aria-describedby="dialog1desc"> <h2 id="dialog1title">your personal details were successfully updated</h2> <p id="dialog1desc">you can change your details at any time in the user account section.</p> <button>close</button> </div> if the dialog box doesn't have a heading, you can instead use aria-label to contain the label text: <div role="dialog" aria-label="personal details updated confirmation"> <p>your personal details were successfully updated.
... examples the title for the reference article about the <title> element is as follows: <title>&lt;title&gt;: the document title element - html: hypertext markup language</title> another example might look like so: <title>fill in your details to register — mygov services</title> to help the user, you can update the page title value to reflect significant page state changes (such as form validation problems): <title>2 errors — fill in your details to register — mygov services</title> see also <title> embedded content must be labeled make sure that elements that embed content have a title attribute that describes the embedded content.
Understandable - Accessibility
see form data validation for comprehensive validation information, and wai-aria: dynamic content updates for information on live regions.
...when a simple instruction or prompt is required, you can use <label> elements for single inputs like name or age, a combination or <label>s and <fieldset>s/<legend>s for multiple inputs that go together (like the elements of a date of birth or postal address).
Accessibility
when the web meets this goal, it is accessible to people with a diverse range of hearing, movement, sight, and cognitive ability." (w3c - accessibility) key tutorials the mdn accessibility learning area contains modern, up-to-date tutorials covering accessibility essentials: what is accessibility?
... wai-aria basics following on from the previous article, sometimes making complex ui controls that involve unsemantic html and dynamic javascript-updated content can be difficult.
:-moz-ui-invalid - CSS: Cascading Style Sheets
the :-moz-ui-invalid css pseudo-class represents any validated form element whose value isn't valid based on their validation constraints, in certain circumstances.
... if the control has focus, and the value was invalid when it gained focus, re-validate on every keystroke.
:-moz-ui-valid - CSS: Cascading Style Sheets
the :-moz-ui-valid css pseudo-class represents any validated form element whose value validates correctly based on its validation constraints.
... if the control has focus, and the value was invalid when it gained focus, re-validate on every keystroke.
:invalid - CSS: Cascading Style Sheets
WebCSS:invalid
the :invalid css pseudo-class represents any <input> or other <form> element whose contents fail to validate.
... syntax :invalid examples this example presents a simple form that colors elements green when they validate and red when they don't.
:is() (:matches(), :any()) - CSS: Cascading Style Sheets
WebCSS:is
hat is being hovered */ :is(header, main, footer) p:hover { color: red; cursor: pointer; } /* the above is equivalent to the following */ header p:hover, main p:hover, footer p:hover { color: red; cursor: pointer; } /* backwards-compatible version with :-*-any() and :matches() (it is not possible to group selectors into single rule, because presence of invalid selector would invalidate whole rule.) */ :-webkit-any(header, main, footer) p:hover { color: red; cursor: pointer; } :-moz-any(header, main, footer) p:hover { color: red; cursor: pointer; } :matches(header, main, footer) p:hover { color: red; cursor: pointer; } syntax :is( <complex-selector-list> )where <complex-selector-list> = <complex-selector>#where <complex-selector> = <compound-selector> [ <combinato...
... article, aside, nav) h1 { font-size: 25px; } /* level 2 */ :is(section, article, aside, nav) :is(section, article, aside, nav) h1 { font-size: 20px; } /* level 3 */ :is(section, article, aside, nav) :is(section, article, aside, nav) :is(section, article, aside, nav) h1 { font-size: 15px; } avoiding selector list invalidation unlike selector lists, the :is() pseudo-class doesn't get invalidated when one of the selectors passed to it isn't supported by the browser.
@import - CSS: Cascading Style Sheets
WebCSS@import
candidate recommendation extended the syntax to support the @supports syntax.
... candidate recommendation media queriesthe definition of '@import' in that specification.
Coordinate systems - CSS: Cascading Style Sheets
handling the mouse events setcoords() is called by the event handler for the various mouse events, named update(); this is shown below.
... function update(e) { setcoords(e, "offset"); setcoords(e, "client"); setcoords(e, "page"); setcoords(e, "screen"); } inner.addeventlistener("mouseenter", update, false); inner.addeventlistener("mousemove", update, false); inner.addeventlistener("mouseleave", update, false); the event handler is in the update() method.
Detecting CSS animation support - CSS: Cascading Style Sheets
this means the browser supports css animation without any prefix, which, to date, none of them do.
... setting the animation property is easy; simply update its value in the style collection.
CSS Flexible Box Layout - CSS: Cascading Style Sheets
the flexbox spec now refers to the box alignment specification for up to date definitions.
... backwards compatibility of flexbox browser status of flexbox, interoperability issues and supporting older browsers and versions of the spec specifications specification status comment css flexible box layout module candidate recommendation initial definition.
CSS Images - CSS: Cascading Style Sheets
specifications specification status comment css images module level 4 working draft added image-resolution, conic-gradient(), and image() css images module level 3 candidate recommendation added image-orientation, image-rendering, object-fit and object-position compatibility standardthe definition of 'css gradients' in that specification.
... candidate recommendation css level 2 (revision 1)the definition of '<uri>' in that specification.
CSS values and units - CSS: Cascading Style Sheets
adds the min(), max() and clamp() functional notation adds toggle() css values and units module level 3 candidate recommendation adds calc(), ch, rem, vw, vw, vmin, vmax, q css color module level 4 working draft adds commaless syntaxes for the rgb(), rgba(), hsl(), and hsla() functions.
... css images module level 4 working draft adds element(), image(), image-set(), conic-gradient() css images module level 3 candidate recommendation initial definition of image.
Introducing the CSS Cascade - CSS: Cascading Style Sheets
WebCSSCascade
specifications specification status comment css cascading and inheritance level 4 candidate recommendation added the revert keyword, which allows rolling a property back a cascade level.
... css cascading and inheritance level 3 candidate recommendation removed the override cascade origin, as it was never used in a w3c standard.
Cubic Bezier Generator - CSS: Cascading Style Sheets
<html> <canvas id="bezier" width="336" height="336"> </canvas> <form> <label for="x1">x1 = </label><input onchange="updatecanvas();" type="text" maxlength=6 id="x1" value="0.79" class='field'> <label for="y1">y1 = </label><input onchange="updatecanvas();return true;" type="text" maxlength=6 id="y1" value="0.33" class='field'> <label for="x2">x2 = </label><input onchange="updatecanvas();return true;" type="text" maxlength=6 id="x2" value="0.14" class='field'> <label for="y2">y2 = </label><input onchange="updatecanvas();return true;" type="text" maxlength=6 id="y2" value="0.53" class='field'> <br> <output id="output">log</output> </form> </html> .field { width: 40px; } function updatecanvas() { var x1 =...
...r x2 = document.getelementbyid('x2'); var y2 = document.getelementbyid('y2'); x2.value = reversex(x); x2.value = math.round(x2.value * 10000) / 10000; y2.value = reversey(y); y2.value = math.round(y2.value * 10000) / 10000; if (x2.value < 0) { x2.value = 0; } if (x2.value > 1) { x2.value = 1; } } updatecanvas(); } } initcanvas(); updatecanvas(); this is a sample tool; it lets you edit bezier curves.
align-items - CSS: Cascading Style Sheets
working draft update to latest syntax definitions.
... candidate recommendation initial definition ...
align-self - CSS: Cascading Style Sheets
working draft update to latest syntax definitions.
... candidate recommendation initial definition.
all - CSS: Cascading Style Sheets
WebCSSall
candidate recommendation added the revert value.
... candidate recommendation initial definition.
<filter-function> - CSS: Cascading Style Sheets
updating the controls updates the filter effect in real time, allowing you to investigate the effects of different filters.
...ilter === 'drop-shadow') { divelem.style.filter = `${selectelem.value}(${math.round(slider.value)}${slider.getattribute('data-unit')} ${math.round(slider.value)}${slider.getattribute('data-unit')} ${math.round(math.abs(slider.value/2))}${slider.getattribute('data-unit')})`; } else { divelem.style.filter = `${selectelem.value}(${slider.value}${slider.getattribute('data-unit')}`; } updateoutput(); updatecurvalue(); } function updateoutput() { output.textcontent = slider.value; } function updatecurvalue() { curvalue.textcontent = `filter: ${divelem.style.filter}`; } setslider(selectelem.value); setdiv(selectelem.value); result specifications specification status filter effects module level 1the definition of 'filter-function' in that specifica...
font-kerning - CSS: Cascading Style Sheets
ij</textarea> css div { font-size: 2rem; font-family: serif; } #nokern { font-kerning: none; } #kern { font-kerning: normal; } javascript let input = document.getelementbyid('input'); let kern = document.getelementbyid('kern'); let nokern = document.getelementbyid('nokern'); input.addeventlistener('keyup', function() { kern.textcontent = input.value; /* update content */ nokern.textcontent = input.value; }); kern.textcontent = input.value; /* initialize content */ nokern.textcontent = input.value; specifications specification status comment css fonts module level 3the definition of 'font-kerning' in that specification.
... candidate recommendation initial definition.
font-size - CSS: Cascading Style Sheets
WebCSSfont-size
changing the font size also updates the sizes of the font size-relative <length> units, such as em, ex, and so forth.
... candidate recommendation no change.
font-style - CSS: Cascading Style Sheets
00vw; overflow: hidden; } body { display: flex; flex-direction: column; } header { margin-bottom: 1.5rem; } .container { flex-grow: 1; } .container > p { margin-top: 0; margin-bottom: 0; } javascript let slantlabel = document.queryselector('label[for="slant"]'); let slantinput = document.queryselector('#slant'); let sampletext = document.queryselector('.sample'); function update() { let slant = `oblique ${slantinput.value}deg`; slantlabel.textcontent = `font-style: ${slant};`; sampletext.style.fontstyle = slant; } slantinput.addeventlistener('input', update); update(); accessibility concerns large sections of text set with a font-style value of italic may be difficult for people with cognitive concerns such as dyslexia to read.
... candidate recommendation no change css level 2 (revision 1)the definition of 'font-style' in that specification.
font-variation-settings - CSS: Cascading Style Sheets
in order to use variable fonts on your operating system, you need to make sure that it is up to date.
...if your operating system is not up to date, you will not be able to use variable fonts in web pages or the firefox developer tools.
font-weight - CSS: Cascading Style Sheets
; overflow: hidden; } body { display: flex; flex-direction: column; } header { margin-bottom: 1.5rem; } .container { flex-grow: 1; } .container > p { margin-top: 0; margin-bottom: 0; } javascript let weightlabel = document.queryselector('label[for="weight"]'); let weightinput = document.queryselector('#weight'); let sampletext = document.queryselector('.sample'); function update() { weightlabel.textcontent = `font-weight: ${weightinput.value};`; sampletext.style.fontweight = weightinput.value; } weightinput.addeventlistener('input', update); update(); accessibility concerns people experiencing low vision conditions may have difficulty reading text set with a font-weight value of 100 (thin/hairline) or 200 (extra light), especially if the font has a low contrast...
... candidate recommendation no change.
inherit - CSS: Cascading Style Sheets
WebCSSinherit
candidate recommendation no changes from level 3.
... candidate recommendation no significant change from css level 2 (revision 1).
initial - CSS: Cascading Style Sheets
WebCSSinitial
candidate recommendation no changes from level 3.
... candidate recommendation initial definition.
mask-border-outset - CSS: Cascading Style Sheets
mask-border-outset: 1rem; chromium-based browsers support an outdated version of this property — mask-box-image-outset — with a prefix: -webkit-mask-box-image-outset: 1rem; note: the mask-border page features a working example (using the out-of-date prefixed border mask properties supported in chromium), so you can get an idea of the effect.
... candidate recommendation initial definition ...
mask-border-repeat - CSS: Cascading Style Sheets
mask-border-repeat: round; chromium-based browsers support an outdated version of this property — mask-box-image-repeat — with a prefix: -webkit-mask-box-image-repeat: round; note: the mask-border page features a working example (using the out-of-date prefixed border mask properties supported in chromium), so you can get an idea of the effect.
... candidate recommendation initial definition ...
mask-border-slice - CSS: Cascading Style Sheets
mask-border-slice: 30 fill; chromium-based browsers support an outdated version of this property — mask-box-image-slice — with a prefix: -webkit-mask-box-image-slice: 30 fill; note: the mask-border page features a working example (using the out-of-date prefixed border mask properties supported in chromium), so you can get an idea of the effect.
... candidate recommendation initial defintion ...
mask-border-source - CSS: Cascading Style Sheets
mask-border-source: url(image.jpg); chromium-based browsers support an outdated version of this property — mask-box-image-source — with a prefix: -webkit-mask-box-image-source: url(image.jpg); note: the mask-border page features a working example (using the out-of-date prefixed border mask properties supported in chromium), so you can get an idea of the effect.
... candidate recommendation initial definition ...
mask-border-width - CSS: Cascading Style Sheets
mask-border-width: 30 fill; chromium-based browsers support an outdated version of this property — mask-box-image-width — with a prefix: -webkit-mask-box-image-width: 20px; note: the mask-border page features a working example (using the out-of-date prefixed border mask properties supported in chromium), so you can get an idea of the effect.
... candidate recommendation initial definition ...
mask-border - CSS: Cascading Style Sheets
-webkit-mask-box-image-repeat: round; -webkit-mask-box-image-outset: 1px; */ /* prefixed shorthand property currently supported in chromium */ -webkit-mask-box-image: url("https://udn.realityripple.com/samples/2d/fd08a3134c.png") /* source */ 30 fill / /* slice */ 20px / /* width */ 1px /* outset */ round; /* repeat */ /* updated standard shorthand property, not supported anywhere yet */ mask-border: url("https://udn.realityripple.com/samples/2d/fd08a3134c.png") /* source */ 30 fill / /* slice */ 20px / /* width */ 1px /* outset */ round; /* repeat */ } result specifications specification status comment css masking module lev...
... candidate recommendation initial definition ...
place-content - CSS: Cascading Style Sheets
ption value="center" selected>center</option> <option value="start">start</option> <option value="end">end</option> <option value="flex-start">flex-start</option> <option value="flex-end">flex-end</option> <option value="left">left</option> <option value="right">right</option> <option value="safe">safe</option> <option value="unsafe">unsafe</option> </select><code>;</code> var update = function () { document.getelementbyid("container").style.placecontent = document.getelementbyid("aligncontentalignment").value + " " + document.getelementbyid("justifycontentalignment").value; } var aligncontentalignment = document.getelementbyid("aligncontentalignment"); aligncontentalignment.addeventlistener("change", update); var justifycontentalignment = document.getelementbyid("justi...
...fycontentalignment"); justifycontentalignment.addeventlistener("change", update); var writingm = document.getelementbyid("writingmode"); writingm.addeventlistener("change", function (evt) { document.getelementbyid("container").style.writingmode = evt.target.value; }); var direction = document.getelementbyid("direction"); direction.addeventlistener("change", function (evt) { document.getelementbyid("container").style.direction = evt.target.value; }); css #container { display: flex; height:240px; width: 240px; flex-wrap: wrap; background-color: #8c8c8c; writing-mode: horizontal-tb; /* can be changed in the live sample */ direction: ltr; /* can be changed in the live sample */ place-content: flex-end center; /* can be changed in the live sample */ } div > div { borde...
<position> - CSS: Cascading Style Sheets
candidate recommendation relists links to both definitions: if css backgrounds and borders module level 3 is supported, its definition of <position> must also be used.
... candidate recommendation defines <position> explicitly and extends it to support offsets from any edge.
<ratio> - CSS: Cascading Style Sheets
WebCSSratio
in media queries level 4, the <ratio> date type is updated to consist of a strictly positive <number> followed by a forward slash ('/', unicode u+002f solidus) and a second strictly positive <number>.
... candidate recommendation media queriesthe definition of '<ratio>' in that specification.
transition-timing-function - CSS: Cascading Style Sheets
: 12em; min-width: 12em; margin-bottom: 4px; background-color: black; border: 1px solid red; color: white; transition-property: all; transition-duration: 7s; } .parent > div.box1{ width: 90vw; min-width: 24em; background-color: magenta; color: yellow; border: 1px solid orange; transition-property: all; transition-duration: 2s; } function updatetransition() { var els = document.queryselectorall(".parent > div[class]"); for(var c = els.length, i = 0; i < c; i++) { els[i].classlist.toggle("box1"); } } var intervalid = window.setinterval(updatetransition, 10000); .ease { transition-timing-function: ease; } .easein { transition-timing-function: ease-in; } .easeout { transition-timing-function: ease-out; } .easeinout {...
...th: 12em; min-width: 12em; margin-bottom: 4px; background-color: black; border: 1px solid red; color: white; transition-property: all; transition-duration:7s; } .parent > div.box1{ width: 90vw; min-width: 24em; background-color: magenta; color: yellow; border: 1px solid orange; transition-property: all; transition-duration:2s; } function updatetransition() { var els = document.queryselectorall(".parent > div[class]"); for(var c = els.length, i = 0; i < c; i++) { els[i].classlist.toggle("box1"); } } var intervalid = window.setinterval(updatetransition, 10000); .jump-start { transition-timing-function: steps(5, jump-start); } .jump-end { transition-timing-function: steps(5, jump-end); } .jump-none { transition-timi...
unset - CSS: Cascading Style Sheets
WebCSSunset
candidate recommendation no changes from level 3.
... candidate recommendation initial definition.
Used value - CSS: Cascading Style Sheets
example this example computes and displays the used width value of three elements (updates on resize): html <div id="no-width"> <p>no explicit width.</p> <p class="show-used-width">..</p> <div id="width-50"> <p>explicit width: 50%.</p> <p class="show-used-width">..</p> <div id="width-inherit"> <p>explicit width: inherit.</p> <p class="show-used-width">..</p> </div> </div> </div> css #no-width { width: auto; } #width-50 { width: 50%; } #...
...width-inherit { width: inherit; } /* make results easier to see */ div { border: 1px solid red; padding: 8px; } javascript function updateusedwidth(id) { var div = document.queryselector(`#${id}`); var par = div.queryselector('.show-used-width'); var wid = window.getcomputedstyle(div)["width"]; par.textcontent = `used width: ${wid}.`; } function updateallusedwidths() { updateusedwidth("no-width"); updateusedwidth("width-50"); updateusedwidth("width-inherit"); } updateallusedwidths(); window.addeventlistener('resize', updateallusedwidths); result difference from computed value css 2.0 defined only computed value as the last step in a property's calculation.
Media buffering, seeking, and time ranges - Developer guides
for (var i = 0; i < myaudio.buffered.length; i++) { if (myaudio.buffered.start(myaudio.buffered.length - 1 - i) < myaudio.currenttime) { document.getelementbyid("buffered-amount").style.width = (myaudio.buffered.end(myaudio.buffered.length - 1 - i) / duration) * 100 + "%"; break; } } } }); myaudio.addeventlistener('timeupdate', function() { var duration = myaudio.duration; if (duration > 0) { document.getelementbyid('progress-amount').style.width = ((myaudio.currenttime / duration)*100) + "%"; } }); } the progress event is fired as data is downloaded, this is a good event to react to if we want to display download or buffering progress.
... the timeupdate event is fired 4 times a second as the media plays and that's where we increment our playing progress bar.
A hybrid approach - Developer guides
similarly, because it uses user-agent detection, you will have to update your detection rules as time goes on.
...subscribe to the mozilla webdev blog for updates about our progress.
Writing forward-compatible websites - Developer guides
if you choose to use them, be prepared to need to frequently update your site to keep up with changes.
... code hygiene avoid missing > passing a validator is one way to ensure this, but even if your website doesn't validate entirely you should make sure all your > characters are present.
HTML attribute: accept - HTML: Hypertext Markup Language
pt=".doc,.docx,application/msword,application/vnd.openxmlformats-officedocument.wordprocessingml.document"> whereas if you're accepting a media file, you may want to be include any format of that media type: <input type="file" id="soundfile" accept="audio/*"> <input type="file" id="videofile" accept="video/*"> <input type="file" id="imagefile" accept="image/*"> the accept attribute doesn't validate the types of the selected files; it simply provides hints for browsers to guide users towards selecting the correct file types.
... because of this, you should make sure that expected requirement is validated server-side.
HTML attribute: max - HTML: Hypertext Markup Language
WebHTMLAttributesmax
valid for the numeric input types, including the date, month, week, time, datetime-local, number and range types, and both the <progress> and <meter> elements, the max attribute is a number that specifies the most positive value a form control to be considered valid.
... syntax syntax for max values by input type input type syntax example date yyyy-mm-dd <input type="date" max="2019-12-25" step="1"> month yyyy-mm <input type="month" max="2019-12" step="12"> week yyyy-w## <input type="week" max="2019-w23" step=""> time hh:mm <input type="time" max="17:00" step="900"> datetime-local yyyy-mm-ddthh:mm <input type="datetime-local" min="2019-12-25t23:59"> number <number> <input type="number" min="0" step="5" max="100"> range <number> <input type="range" min="60" step...
<address>: The Contact Address element - HTML: Hypertext Markup Language
WebHTMLElementaddress
in the latest spec versions however, its definition has been updated so it can now be used to mark up arbitrary addresses.
... this element should not contain more information than the contact information, like a publication date (which belongs in a <time> element).
<button>: The Button element - HTML: Hypertext Markup Language
WebHTMLElementbutton
formnovalidate html5 if the button is a submit button, this boolean attribute specifies that the form is not to be validated when it is submitted.
... if this attribute is specified, it overrides the novalidate attribute of the button's form owner.
<form> - HTML: Hypertext Markup Language
WebHTMLElementform
novalidate this boolean attribute indicates that the form shouldn't be validated when submitted.
... if this attribute is not set (and therefore the form is validated), it can be overridden by a formnovalidate attribute on a <button>, <input type="submit">, or <input type="image"> element belonging to the form.
<input type="checkbox"> - HTML: Hypertext Markup Language
WebHTMLElementinputcheckbox
(only the htmlinputelement’s checked idl attribute is updated.) note: unlike other input controls, a checkboxes value is only included in the submitted data if the checkbox is currently checked.
... var overall = document.queryselector('input[id="enchtbl"]'); var ingredients = document.queryselectorall('ul input'); overall.addeventlistener('click', function(e) { e.preventdefault(); }); for(var i = 0; i < ingredients.length; i++) { ingredients[i].addeventlistener('click', updatedisplay); } function updatedisplay() { var checkedcount = 0; for(var i = 0; i < ingredients.length; i++) { if(ingredients[i].checked) { checkedcount++; } } if(checkedcount === 0) { overall.checked = false; overall.indeterminate = false; } else if(checkedcount === ingredients.length) { overall.checked = true; overall.indeterminat...
<input type="search"> - HTML: Hypertext Markup Language
WebHTMLElementinputsearch
this allows your code to update the search results in real time as the user edits the search.
...if your server-side code fails to validate the data it receives, disaster could strike when improperly-formatted data (or data which is too large, is of the wrong type, and so forth) is entered into your database.
<kbd>: The Keyboard Input element - HTML: Hypertext Markup Language
WebHTMLElementkbd
by convention, the user agent defaults to rendering the contents of a <kbd> element using its default monospace font, although this is not mandated by the html standard.
... result the output looks like this without a style sheet applied: with custom styles we can make more sense of this by adding some css: css we add a new style for <kbd> elements, key, which we can apply when rendering keyboard keys: kbd.key { border-radius: 3px; padding: 1px 2px 0; border: 1px solid black; } html then we update the html to use this class on the keys in the output to be presented: <p>you can also create a new document by pressing <kbd><kbd class="key">ctrl</kbd>+<kbd class="key">n</kbd></kbd>.</p> result the result is just what we want!
<summary>: The Disclosure Summary element - HTML: Hypertext Markup Language
WebHTMLElementsummary
basic example a simple example showing the use of <summary> in a <details> element: <details open> <summary>overview</summary> <ol> <li>cash on hand: $500.00</li> <li>current invoice: $75.30</li> <li>due date: 5/6/19</li> </ol> </details> summaries as headings you can use heading elements in <summary>, like this: <details open> <summary><h4>overview</h4></summary> <ol> <li>cash on hand: $500.00</li> <li>current invoice: $75.30</li> <li>due date: 5/6/19</li> </ol> </details> this currently has some spacing issues that could be addressed using css.
... html in summaries this example adds some semantics to the <summary> element to indicate the label as important: <details open> <summary><strong>overview</strong></summary> <ol> <li>cash on hand: $500.00</li> <li>current invoice: $75.30</li> <li>due date: 5/6/19</li> </ol> </details> specifications specification status comment html living standardthe definition of '<summary>' in that specification.
itemid - HTML: Hypertext Markup Language
hamilton <dt>publication date <dd><time itemprop="pubdate" datetime="1996-01-26">26 january 1996</time> </dl> structured data itemscope itemtype: itemid http://vocab.example.net/book: urn:isbn:0-330-34032-8 itemprop title the reality dysfunction itemprop author peter f.
... hamilton itemprop pubdate 1996-01-26 result specifications specification status comment html living standardthe definition of 'itemid' in that specification.
Microdata - HTML: Hypertext Markup Language
this vocabulary defines a standard set of type names and property names, for example, schema.org music event indicates a concert performance, with startdate and location properties to specify the concert's key details.
... in this case, schema.org music event would be the url used by itemtype and startdate and location would be itemprop's that schema.org music event defines.
HTML reference - HTML: Hypertext Markup Language
date and time formats used in html certain html elements allow you to specify dates and/or times as the value or as the value of an attribute.
... these include the date and time variations of the <input> element as well as the <ins> and <del> elements.
MIME types (IANA media types) - HTTP
the internet assigned numbers authority (iana) is responsible for all official mime types, and you can find the most up-to-date and complete list at their media types page.
... audio and video types as is the case for images, html doesn't mandate that web browsers support any specific file and codec types for the <audio> and <video> elements, so it's important to consider your target audience and the range of browsers (and versions of those browsers) they may be using when choosing the file type and codecs to use for media.
Feature Policy - HTTP
the feature-policy header has now been renamed to permissions-policy in the spec, and this article will eventually be updated to reflect that change.
... block the use of outdated apis like synchronous xhr and document.write().
Content-Security-Policy - HTTP
mixed content candidate recommendation adds block-all-mixed-content.
... upgrade insecure requests candidate recommendation adds upgrade-insecure-requests.
Last-Modified - HTTP
the last-modified response http header contains the date and time at which the origin server believes the resource was last modified.
...http dates are always expressed in gmt, never in local time.
Retry-After - HTTP
header type response header forbidden header name no syntax retry-after: <http-date> retry-after: <delay-seconds> directives <http-date> a date after which to retry.
... see the date header for more details on the http date format.
Tk - HTTP
WebHTTPHeadersTk
(dynamic) tk: g (gateway or multiple parties) tk: n (not tracking) tk: t (tracking) tk: c (tracking with consent) tk: p (potential consent) tk: d (disregarding dnt) tk: u (updated) directives !
... u updated.
Link prefetching FAQ - HTTP
however, it is possible to instruct mozilla to validate a prefetched document when the user follows a href to the prefetched document by specifying the cache-control: must-revalidate http response header.
... prefetching hints original document information author(s): darin fisher (darin at meer dot net) last updated date: updated: march 3, 2003 ...
OPTIONS - HTTP
WebHTTPMethodsOPTIONS
/1.1 options * http/1.1 examples identifying allowed request methods to find out which request methods a server supports, one can use the curl command-line program to issue an options request: curl -x options https://example.org -i the response then contains an allow header that holds the allowed methods: http/1.1 204 no content allow: options, get, head, post cache-control: max-age=604800 date: thu, 13 oct 2016 11:45:00 gmt server: eos (lax004/2813) preflighted requests in cors in cors, a preflight request is sent with the options method so that the server can respond if it is acceptable to send the request.
... http/1.1 204 no content date: mon, 01 dec 2008 01:15:39 gmt server: apache/2.0.61 (unix) access-control-allow-origin: https://foo.example access-control-allow-methods: post, get, options access-control-allow-headers: x-pingother, content-type access-control-max-age: 86400 vary: accept-encoding, origin keep-alive: timeout=2, max=100 connection: keep-alive specifications specification title rfc 7231,...
HTTP resources and specifications - HTTP
cross-origin resource sharing living standard rfc 7034 http header field x-frame-options informational rfc 6797 http strict transport security (hsts) proposed standard upgrade insecure requests upgrade insecure requests candidate recommendation content security policy 1.0 content security policy 1.0 csp 1.1 and csp 3.0 doesn't extend the http standard obsolete microsoft document specifying legacy document modes* defines x-ua-compatible note rfc 5689 http extensions for web distributed authoring and versioning (webdav) these extensions of the web, as well as carddav and...
... 2324 hyper text coffee pot control protocol (htcpcp/1.0) april 1st joke spec rfc 7168 the hyper text coffee pot control protocol for tea efflux appliances (htcpcp-tea) april 1st joke spec html living standard html defines extensions of http for server-sent events living standard tracking preference expression dnt header editor's draft / candidate recommendation reporting api report-to header draft draft spec expect-ct extension for http ietf draft ...
206 Partial Content - HTTP
WebHTTPStatus206
status 206 partial content examples a response containing one single range: http/1.1 206 partial content date: wed, 15 nov 2015 06:25:24 gmt last-modified: wed, 15 nov 2015 04:58:08 gmt content-range: bytes 21010-47021/47022 content-length: 26012 content-type: image/gif ...
... a response containing several ranges: http/1.1 206 partial content date: wed, 15 nov 2015 06:25:24 gmt last-modified: wed, 15 nov 2015 04:58:08 gmt content-length: 1741 content-type: multipart/byteranges; boundary=string_separator --string_separator content-type: application/pdf content-range: bytes 234-639/8000 ...the first range...
HTTP
WebHTTP
rudp — the reliable update of udp — is a suitable alternative.
...the cookie can also be set to expire on a certain date, or restricted to a specific domain and path.
CSS Houdini
browsers parse the cssom — including layout, paint, and composite processes — before applying any style updates found in scripts.
... in addition, layout, paint, and composite processes are repeated for javascript style updates.
Concurrency model and the event loop - JavaScript
here is an example that demonstrates this concept (settimeout does not run immediately after its timer expires): const s = new date().getseconds(); settimeout(function() { // prints out "2", meaning that the callback is not called immediately after 500 milliseconds.
... console.log("ran after " + (new date().getseconds() - s) + " seconds"); }, 500) while (true) { if (new date().getseconds() - s >= 2) { console.log("good, looped for 2 seconds") break; } } zero delays zero delay doesn't actually mean the call back will fire-off after zero milliseconds.
extends - JavaScript
this.name = 'square'; } get area() { return this.height * this.width; } } using extends with built-in objects this example extends the built-in date object.
... class mydate extends date { getformatteddate() { var months = ['jan', 'feb', 'mar', 'apr', 'may', 'jun', 'jul', 'aug', 'sep', 'oct', 'nov', 'dec']; return this.getdate() + '-' + months[this.getmonth()] + '-' + this.getfullyear(); } } specifications specification ecmascript (ecma-262)the definition of 'extends' in that specification.
JavaScript error reference - JavaScript
error: permission denied to access property "x"internalerror: too much recursionrangeerror: argument is not a valid code pointrangeerror: invalid array lengthrangeerror: invalid daterangeerror: precision is out of rangerangeerror: radix must be an integerrangeerror: repeat count must be less than infinityrangeerror: repeat count must be non-negativereferenceerror: "x" is not definedreferenceerror: assignment to undeclared variable "x"referenceerror: can't access lexical declaration "x" before initializationreferenceerror: deprecated caller or arguments usagereferenceerror: in...
... argumenttypeerror: invalid argumentstypeerror: invalid assignment to const "x"typeerror: property "x" is non-configurable and can't be deletedtypeerror: setting getter-only property "x"typeerror: variable "x" redeclares argumenturierror: malformed uri sequencewarning: 08/09 is not a legal ecma-262 octal constantwarning: -file- is being assigned a //# sourcemappingurl, but already has onewarning: date.prototype.tolocaleformat is deprecatedwarning: javascript 1.6's for-each-in loops are deprecatedwarning: string.x is deprecated; use string.prototype.x insteadwarning: expression closures are deprecatedwarning: unreachable code after return statement ...
The arguments object - JavaScript
non-strict functions that are passed only simple parameters (that is, not rest, default, or restructured parameters) will sync the value of variables new values in the body of the function with the arguments object, and vice versa: function func(a) { arguments[0] = 99; // updating arguments[0] also updates a console.log(a); } func(10); // 99 and also: function func(a) { a = 99; // updating a also updates arguments[0] console.log(arguments[0]); } func(10); // 99 conversely, non-strict functions that are passed rest, default, or destructured parameters will not sync new values assigned to argument variables in the function body with the arguments object.
... instead, the arguments object in non-strict functions with complex parameters will always reflect the values passed to the function when the function was called (this is the same behavior as exhibited by all strict-mode functions, regardless of the type of variables they are passed): function func(a = 55) { arguments[0] = 99; // updating arguments[0] does not also update a console.log(a); } func(10); // 10 and also: function func(a = 55) { a = 99; // updating a does not also update arguments[0] console.log(arguments[0]); } func(10); // 10 and also: // an untracked default parameter function func(a = 55) { console.log(arguments[0]); } func(); // undefined specifications specification ecmascript (ecma-262)the definition of 'arguments exotic objects' in th...
Array.prototype.indexOf() - JavaScript
; // -1 array.indexof(2, -3); // 0 finding all the occurrences of an element var indices = []; var array = ['a', 'b', 'a', 'c', 'a', 'd']; var element = 'a'; var idx = array.indexof(element); while (idx != -1) { indices.push(idx); idx = array.indexof(element, idx + 1); } console.log(indices); // [0, 2, 4] finding if an element exists in the array or not and updating the array function updatevegetablescollection (veggies, veggie) { if (veggies.indexof(veggie) === -1) { veggies.push(veggie); console.log('new veggies collection is : ' + veggies); } else if (veggies.indexof(veggie) > -1) { console.log(veggie + ' already exists in the veggies collection.'); } } var veggies = ['potato', 'tomato', 'chillies', 'green-pepper']; updatevegetablescollection(...
...veggies, 'spinach'); // new veggies collection is : potato,tomato,chillies,green-pepper,spinach updatevegetablescollection(veggies, 'spinach'); // spinach already exists in the veggies collection.
Array.prototype.toLocaleString() - JavaScript
options optional an object with configuration properties, for numbers see number.prototype.tolocalestring(), and for dates see date.prototype.tolocalestring().
... object: object.prototype.tolocalestring() number: number.prototype.tolocalestring() date: date.prototype.tolocalestring() always display the currency for the strings and numbers in the prices array: var prices = ['ï¿¥7', 500, 8123, 12]; prices.tolocalestring('ja-jp', { style: 'currency', currency: 'jpy' }); // "ï¿¥7,ï¿¥500,ï¿¥8,123,ï¿¥12" for more examples, see also the intl, numberformat, and datetimeformat pages.
Array - JavaScript
other methods (e.g., push(), splice(), etc.) also result in updates to an array's length property.
... const fruits = [] fruits.push('banana', 'apple', 'peach') console.log(fruits.length) // 3 when setting a property on a javascript array when the property is a valid array index and that index is outside the current bounds of the array, the engine will update the array's length property accordingly: fruits[5] = 'mango' console.log(fruits[5]) // 'mango' console.log(object.keys(fruits)) // ['0', '1', '2', '5'] console.log(fruits.length) // 6 increasing the length.
Function.prototype.apply() - JavaScript
rray = [4, 'hello world!', false]; let myinstance = myconstructor.construct(myarray); console.log(myinstance.property1); // logs 'hello world!' console.log(myinstance instanceof myconstructor); // logs 'true' console.log(myinstance.constructor); // logs 'myconstructor' note: this non-native function.construct method will not work with some native constructors; like date, for example.
... for example, imagine having an array like the following, to be used with date constructor: [2012, 11, 4]; in this case you have to write something like: new (function.prototype.bind.apply(date, [null].concat([2012, 11, 4])))().
Function.prototype.bind() - JavaScript
polyfill because older browsers are generally also slower browsers, it is far more critical than most people recognize to create performance polyfills to make the browsing experience in outdated browsers slightly less horrible.
...(proper bound functions have none.) the partial implementation creates bound functions whose length property does not agree with that mandated by ecma-262: it creates functions with length of 0.
JSON.stringify() - JavaScript
the instances of date implement the tojson() function by returning a string (the same as date.toisostring()).
... examples using json.stringify json.stringify({}); // '{}' json.stringify(true); // 'true' json.stringify('foo'); // '"foo"' json.stringify([1, 'false', false]); // '[1,"false",false]' json.stringify([nan, null, infinity]); // '[null,null,null]' json.stringify({ x: 5 }); // '{"x":5}' json.stringify(new date(2006, 0, 2, 15, 4, 5)) // '"2006-01-02t15:04:05.000z"' json.stringify({ x: 5, y: 6 }); // '{"x":5,"y":6}' json.stringify([new number(3), new string('false'), new boolean(false)]); // '[3,"false",false]' // string-keyed array elements are not enumerable and make no sense in json let a = ['foo', 'bar']; a['baz'] = 'quux'; // a: [ 0: 'foo', 1: 'bar', baz: 'quux' ] json.stringify(a); // '["foo...
Map.prototype.set() - JavaScript
the set() method adds or updates an element with a specified key and a value to a map object.
... examples using set() let mymap = new map() // add new elements to the map mymap.set('bar', 'foo') mymap.set(1, 'foobar') // update an element in the map mymap.set('bar', 'baz') using the set() with chaining since the set() method returns back the same map object, you can chain the method call like below: // add new elements to the map with chaining.
Object.prototype.constructor - JavaScript
function type () {} let types = [ new array(), [], new boolean(), true, // remains unchanged new date(), new error(), new function(), function () {}, math, new number(), 1, // remains unchanged new object(), {}, new regexp(), /(?:)/, new string(), 'test' // remains unchanged ] for (let i = 0; i < types.length; i++) { types[i].constructor = type types[i] = [types[i].constructor, types[i] instanceof type, types[i].tostring()] } console.log(typ...
...nction type() {},false, // new array() function type() {},false, // [] function type() {},false,false // new boolean() function boolean() { [native code] },false,true // true function type() {},false,mon sep 01 2014 16:03:49 gmt+0600 // new date() function type() {},false,error // new error() function type() {},false,function anonymous() { } // new function() function type() {},false,function () {} // function () {} function type() {},false,[object math] // math function type() {},false,0 ...
Object.prototype.toLocaleString() - JavaScript
objects overriding tolocalestring array: array.prototype.tolocalestring() number: number.prototype.tolocalestring() date: date.prototype.tolocalestring() typedarray: typedarray.prototype.tolocalestring() bigint: bigint.prototype.tolocalestring() examples array tolocalestring() override on array objects, tolocalestring() can be used to print array values as a string, optionally with locale-specific identifiers (such as currency symbols) appended to them: for example: const testarray = [4, 7, 10]; let europr...
...ices = testarray.tolocalestring('fr', { style: 'currency', currency: 'eur'}); // "4,00 €,7,00 €,10,00 €" date tolocalestring() override on date objects, tolocalestring() is used to print out date displays more suitable for specific locales: for example: const testdate = new date(date.now()); // "date fri may 29 2020 18:04:24 gmt+0100 (british summer time)" let dedate = testdate.tolocalestring('de'); // "29.5.2020, 18:04:24" var frdate = testdate.tolocalestring('fr'); //"29/05/2020 à 18:04:24" number tolocalestring() override on number objects, tolocalestring() is used to print out number displays more suitable for specific locales, e.g.
Object.prototype.toString() - JavaScript
const tostring = object.prototype.tostring; tostring.call(new date); // [object date] tostring.call(new string); // [object string] tostring.call(math); // [object math] // since javascript 1.8.5 tostring.call(undefined); // [object undefined] tostring.call(null); // [object null] using tostring() in this way is unreliable; objects can change the behavior of object.prototype.tostring() by defining a symbol.tostringtag property, leading to ...
...for example: const mydate = new date(); object.prototype.tostring.call(mydate); // [object date] mydate[symbol.tostringtag] = 'mydate'; object.prototype.tostring.call(mydate); // [object mydate] date.prototype[symbol.tostringtag] = 'prototype polluted'; object.prototype.tostring.call(new date()); // [object prototype polluted] specifications specification ecmascript (ecma-262)the definition of 'object.prototype.tostring' in that specification.
WebAssembly - JavaScript
webassembly.validate() validates a given typed array of webassembly binary code, returning whether the bytes are valid webassembly code (true) or not (false).
... 61firefox android full support 58opera android full support 45safari ios no support nosamsung internet android full support 8.0nodejs no support novalidatechrome full support 57edge full support 16firefox full support 52notes full support 52notes notes disabled in the firefox 52 extended support release (esr).ie no support noop...
JavaScript reference - JavaScript
obalthis function properties eval() isfinite() isnan() parsefloat() parseint() decodeuri() decodeuricomponent() encodeuri() encodeuricomponent() fundamental objects object function boolean symbol error objects error aggregateerror evalerror internalerror rangeerror referenceerror syntaxerror typeerror urierror numbers & dates number bigint math date text processing string regexp indexed collections array int8array uint8array uint8clampedarray int16array uint16array int32array uint32array float32array float64array bigint64array biguint64array keyed collections map set weakmap weakset structured data arraybuffer sharedarraybuffer atomics datavie...
...w json control abstraction promise generator generatorfunction asyncfunction reflection reflect proxy internationalization intl intl.collator intl.datetimeformat intl.displaynames intl.listformat intl.locale intl.numberformat intl.pluralrules intl.relativetimeformat webassembly webassembly webassembly.module webassembly.instance webassembly.memory webassembly.table webassembly.compileerror webassembly.linkerror webassembly.runtimeerror statements javascript statements and declarations control flowblock break continue empty if...else switch throw try...catch declarations var let const functions and classes function function* async function return class iteration...
serviceworker - Web app manifests
examples "serviceworker": { "src": "./serviceworker.js", "scope": "/app", "type": "", "update_via_cache": "none" } values service worker contain the following values (only src is required): member description src the url to download the service worker script from.
... update_via_cache whether the user agent cache should be bypassed when fetching the service worker.
OpenSearch description format
supporting automatic updates for opensearch plugins opensearch plugins can automatically update.
...the template attribute should be the url of the opensearch document to automatically update to.
Optimizing startup performance - Web Performance
the source application might have a main loop that can easily be made to operate asynchronously (by running each main loop iteration separately); startup is often just a continuous, monolithic procedure that might periodically update a progress meter.
...in between calculations, update your progress indicator, make changes to the display, or anything else you might be able to do to help the user feel like your app is doing something instead of sitting there quietly.
Progressive web app structure - Progressive web apps (PWAs)
client-side rendering (csr) allows the website to be updated in the browser almost instantly when navigating to different pages, but requires more of an initial download hit and extra rendering on the client at the beginning.
... mixing ssr with csr can lead to the best results — you can render a website on the server, cache its contents, and then update the rendering on the client-side as and when needed.
Making PWAs work offline with Service workers - Progressive web apps (PWAs)
updates there is still one point to cover: how do you upgrade a service worker when a new version of the app containing new assets is available?
... the version number in the cache name is key to this: var cachename = 'js13kpwa-v1'; when this updates to v2, we can then add all of our files (including our new files) to a new cache: contenttocache.push('/pwa-examples/js13kpwa/icons/icon-32.png'); // ...
How to make PWAs re-engageable using Notifications and Push - Progressive web apps (PWAs)
notifications can be used by the service worker to show new information to the user, or at least alert them when something has been updated.
... they work outside of the browser window, just like service workers, so updates can be pushed and notifications can be shown when the app's page is out of focus or even closed.
Structural overview of progressive web apps - Progressive web apps (PWAs)
client-side rendering (csr) allows the website to be updated in the browser almost instantly when navigating to different pages, but requires more of an initial download hit and extra rendering on the client at the beginning.
... the best results tend to come when you use both client-side and server-side rendering; you can render a web site on the server, cache its contents, and then update the rendering on the client side as needed.
cx - SVG: Scalable Vector Graphics
WebSVGAttributecx
candidate recommendation definition as a geometry property scalable vector graphics (svg) 2the definition of 'cx' in that specification.
... candidate recommendation definition for svg2 paint servers.
cy - SVG: Scalable Vector Graphics
WebSVGAttributecy
candidate recommendation definition as a geometry property scalable vector graphics (svg) 2the definition of 'cy' in that specification.
... candidate recommendation definition for svg2 paint servers.
gradientTransform - SVG: Scalable Vector Graphics
candidate recommendation no change scalable vector graphics (svg) 2the definition of 'gradienttransformation for <radialgradient>' in that specification.
... candidate recommendation no change scalable vector graphics (svg) 1.1 (second edition)the definition of 'gradienttransformation for <lineargradient>' in that specification.
gradientUnits - SVG: Scalable Vector Graphics
candidate recommendation no change scalable vector graphics (svg) 2the definition of 'gradientunits for <lineargradient>' in that specification.
... candidate recommendation no change scalable vector graphics (svg) 1.1 (second edition)the definition of 'gradientunits for <radialgradient>' in that specification.
image-rendering - SVG: Scalable Vector Graphics
candidate recommendation definition in css scalable vector graphics (svg) 2the definition of 'image-rendering' in that specification.
... candidate recommendation no significant change, only added a reference to css images 3 scalable vector graphics (svg) 1.1 (second edition)the definition of 'image-rendering' in that specification.
points - SVG: Scalable Vector Graphics
WebSVGAttributepoints
candidate recommendation definition for <polygon> scalable vector graphics (svg) 2the definition of 'points' in that specification.
... candidate recommendation definition for <polyline> scalable vector graphics (svg) 1.1 (second edition)the definition of 'points' in that specification.
r - SVG: Scalable Vector Graphics
WebSVGAttributer
candidate recommendation definition as a geometry property scalable vector graphics (svg) 2the definition of 'r' in that specification.
... candidate recommendation definition for svg2 paint servers <radialgradient> scalable vector graphics (svg) 1.1 (second edition)the definition of 'r' in that specification.
refX - SVG: Scalable Vector Graphics
WebSVGAttributerefX
candidate recommendation added keywords left, center, and right.
... candidate recommendation initial definition for <symbol> scalable vector graphics (svg) 1.1 (second edition)the definition of 'refx' in that specification.
refY - SVG: Scalable Vector Graphics
WebSVGAttributerefY
candidate recommendation added keywords left, center, and right.
... candidate recommendation initial definition for <symbol> scalable vector graphics (svg) 1.1 (second edition)the definition of 'refy' in that specification.
spreadMethod - SVG: Scalable Vector Graphics
candidate recommendation no change scalable vector graphics (svg) 2the definition of 'spreadmethod for <lineargradient>' in that specification.
... candidate recommendation no change scalable vector graphics (svg) 1.1 (second edition)the definition of 'spreadmethod for <radialgradient>' in that specification.
text-decoration - SVG: Scalable Vector Graphics
candidate recommendation defines the property as a shorthand for text-decoration-line, text-decoration-style, and text-decoration-color.
... candidate recommendation mainly refers to the definition in css text decoration 3 turning the property into a shorthand for text-decoration-line and text-decoration-style.
textLength - SVG: Scalable Vector Graphics
after updating the text width, the contents of the widthdisplay box are updated with the new value as well, and we're finished.
... candidate recommendation allowed percentages and numbers as values.
x1 - SVG: Scalable Vector Graphics
WebSVGAttributex1
candidate recommendation definition for <line> scalable vector graphics (svg) 2the definition of 'x1' in that specification.
... candidate recommendation definition for <lineargradient> scalable vector graphics (svg) 1.1 (second edition)the definition of 'x1' in that specification.
x2 - SVG: Scalable Vector Graphics
WebSVGAttributex2
candidate recommendation definition for <line> scalable vector graphics (svg) 2the definition of 'x2' in that specification.
... candidate recommendation definition for <lineargradient> scalable vector graphics (svg) 1.1 (second edition)the definition of 'x2' in that specification.
y1 - SVG: Scalable Vector Graphics
WebSVGAttributey1
candidate recommendation definition for <line> scalable vector graphics (svg) 2the definition of 'y1' in that specification.
... candidate recommendation definition for <lineargradient> scalable vector graphics (svg) 1.1 (second edition)the definition of 'y1' in that specification.
y2 - SVG: Scalable Vector Graphics
WebSVGAttributey2
candidate recommendation definition for <line> scalable vector graphics (svg) 2the definition of 'y2' in that specification.
... candidate recommendation definition for <lineargradient> scalable vector graphics (svg) 1.1 (second edition)the definition of 'y2' in that specification.
Introduction to using XPath in JavaScript - XPath
note however, that if the document is mutated (the document tree is modified) between iterations that will invalidate the iteration and the invaliditeratorstate property of xpathresult is set to true, and a ns_error_dom_invalid_state_err exception is thrown.
... last updated date: 2006-3-25.
Using the WebAssembly JavaScript API - WebAssembly
tables can be mutated via table.prototype.set(), which updates one of the values in a table, and table.prototype.grow(), which increases the number of values that can be stored in a table.
...: ${got}<br>`; } asserteq("webassembly.global exists", typeof webassembly.global, "function"); const global = new webassembly.global({value:'i32', mutable:true}, 0); webassembly.instantiatestreaming(fetch('global.wasm'), { js: { global } }) .then(({instance}) => { asserteq("getting initial value from wasm", instance.exports.getglobal(), 0); global.value = 42; asserteq("getting js-updated value from wasm", instance.exports.getglobal(), 42); instance.exports.incglobal(); asserteq("getting wasm-updated value from js", global.value, 43); }); note: you can see the example running live on github; see also the source code.
2015 MDN Fellowship Program - Archive of obsolete content
github: chrisdavidmills twitter: @chrisdavidmills why increase the reach and impact of your expertise grow your skills beyond coding and managing to educating and communicating build something used by hundreds of thousands (or more) developers worldwide directly impact and grow the value of the open web when application deadline: april 1, 2015 orientation: early june (dates tbd) graduation: august 11-12, 2015 where orientation: a mozilla location (tbd).
Firefox Compatibility - Archive of obsolete content
this page is out of date: now the sdk ships inside firefox, compatibility between the sdk modules and firefox versions is no longer an issue.
Program ID - Archive of obsolete content
for example: addons.mozilla.org uses it to distinguish between new add-ons and updates to existing add-ons, and the simple-storage module uses it to figure out which stored data belongs to which add-on.
indexed-db - Archive of obsolete content
db.deleteobjectstore("items"); } var store = db.createobjectstore("items", {keypath: "time"}); }; request.onsuccess = function(e) { database.db = e.target.result; }; request.onerror = database.onerror; }; function additem(name) { var db = database.db; var trans = db.transaction(["items"], "readwrite"); var store = trans.objectstore("items"); var time = new date().gettime(); var request = store.put({ "name": name, "time": time }); request.onerror = database.onerror; }; function getitems(callback) { var cb = callback; var db = database.db; var trans = db.transaction(["items"], "readwrite"); var store = trans.objectstore("items"); var items = new array(); trans.oncomplete = function() { cb(items); } var keyrange = idbk...
request - Archive of obsolete content
examples outlined in this document are no longer relevent in regards to the twitter api calls and need to be updated make simple network requests.
system - Archive of obsolete content
for example: "msvc", "n32", "gcc2", "gcc3", "sunc", "ibmc" var system = require("sdk/system"); console.log("compiler = " + system.compiler); build an identifier for the specific build, derived from the build date.
url - Archive of obsolete content
experimental construct, validate, and parse urls.
High-Level APIs - Archive of obsolete content
url construct, validate, and parse urls.
content/loader - Archive of obsolete content
loader adds code to initialize and validate a set of properties for managing content scripts: contenturl contentscript contentscriptfile contentscriptwhen contentscriptoptions allow when certain of these properties are set, the loader emits a propertychange event, enabling its users to take the appropriate action.
test/assert - Archive of obsolete content
if the expected value is a date object, the actual value is equivalent if it is also a date object that refers to the same time.
ui/sidebar - Archive of obsolete content
<!doctype html> <html> <head> <link href="stuff.css" type="text/css" rel="stylesheet"> </head> <body> <script type="text/javascript" src="stuff.js"></script> </body> </html> you can update the sidebar's content by setting the sidebar's url property.
Release notes - Archive of obsolete content
updated the default theme used for panels on mac os x.
Using third-party modules (jpm) - Archive of obsolete content
before the jpm tool was available, there wasn't any package manager for these community-developed modules, so it wasn't obvious where to find community-developed modules, or how to install and update them.
Bootstrapped extensions - Archive of obsolete content
this happens at application launch time, when the extension is enabled after being disabled or after it has been shut down in order to install an update.
Cookies - Archive of obsolete content
services.cookies.add(".host.example.com", "/cookie-path", "cookie_name", "cookie_value", is_secure, is_http_only, is_session, expiry_date); see also document.cookie nsicookie nsicookie2 nsicookieservice nsicookiemanager nsicookiemanager2 http cookies ...
Finding window handles - Archive of obsolete content
comparing to the method above, by using this method, you don't have to compile your component with nsiwidget.h and other bunchs of h files that should not be exposed to outside, and could change every time firefox updates, all you need is nsibasewindow.idl(it's not in gecko_sdk, get this from the latest firefox source, or http://mxr.mozilla.org/mozilla/sourc...basewindow.idl), and use xpidl to compile it to .h file, although that's stll a unfrozen interface, but it should be a lot better.
Miscellaneous - Archive of obsolete content
ort("resource://gre/modules/addonmanager.jsm"); addonmanager.getaddonbyid("extension-guid@example.org", function(addon) { // this is an asynchronous callback function that might not be called immediately alert("my extension's version is " + addon.version); }); restarting firefox/thunderbird/seamonkey_2.0 for firefox 3 see onwizardfinish around here: http://mxr.mozilla.org/seamonkey/sou...pdates.js#1639 for firefox 2 see around here: http://mxr.mozilla.org/mozilla1.8/so...pdates.js#1631 bug 338039 tracks improving this situation by providing a simple method to restart the application.
Toolbar - Archive of obsolete content
notes insert your button by default only once, at first run, or when an extension update adds a new button.
Extension Etiquette - Archive of obsolete content
make one only if you have a special feature that needs to be included — for example, a custom updater.
Inline options - Archive of obsolete content
so like for the type="file", once a user browses and picks a file, when it updates the label it will trigger the oninputchanged attribute.
Migrating raw components to add-ons - Archive of obsolete content
as we roll this new behavior out, this document will be updated with additional information addressing scenarios we see developers encountering.
Chapter 2: Technologies used in developing extensions - Archive of obsolete content
it has a number of useful qualities: it is generic, extensible, and easy to validate as well-formed.
Adding Events and Commands - Archive of obsolete content
you should at least validate the url of the page that is generating the custom event, so that you know that it's coming from the right place.
Adding Toolbars and Toolbar Buttons - Archive of obsolete content
remember to validate if your button is already present, to prevent duplicates.
Appendix A: Add-on Performance - Archive of obsolete content
note: see the newer article performance best practices in extensions for more up-to-date information about how to optimize the performance of your add-on.
Appendix F: Monitoring DOM changes - Archive of obsolete content
hashchange and popstate events most ajax-heavy sites update the url when they significantly change their content, either via a change to the fragment identifier (hash) or more recently via the history.pushstate method.
Connecting to Remote Content - Archive of obsolete content
you can discover some interesting things about firefox like this, such as the automatic update urls for extensions, and the behavior of web applications such as gmail.
Custom XUL Elements with XBL - Archive of obsolete content
encapsulation mandates that you try to keep your xbl free of outside dependencies.
Appendix E: DOM Building and Insertion (HTML & XUL) - Archive of obsolete content
document.body.appendchild(parsehtml(document, xhr.responsetext, true, xhr.channel.uri)); see also displaying web content in an extension without security issues how to create a dom tree node.textcontent node.appendchild() element.setattribute() document.createelement() document.createtextnode() original document information author(s): kris maglione last updated date: 2011-08-08 ...
Handling Preferences - Archive of obsolete content
this file is updated when preferences are modified by the user.
Local Storage - Archive of obsolete content
they allow you to automatically generate xul content using information from a datasource, and automatically update the content once the datasource changes.
Setting Up a Development Environment - Archive of obsolete content
that is because make can tell that the file in the bin directory is up to date, and nothing needs to be done.
XUL School Tutorial - Archive of obsolete content
while firefox changes rapidly, the content in this tutorial should be up to date and valid.
Performance best practices in extensions - Archive of obsolete content
remember that any selector in your rule which might match many different nodes is a source of inefficiency during either selector matching or dynamic update processing.
Session store API - Archive of obsolete content
firefox 3 note in firefox 3 and later, if you need to detect when a tab is about to be closed so that you can update data associated with the tab before it is closed, you can watch for the "sstabclosing" event, which is sent to the tab.
Setting up an extension development environment - Archive of obsolete content
this will send more detailed information about installation and update problems to the error console.
Signing an extension - Archive of obsolete content
note: these instructions are outdated.
Using Dependent Libraries In Extension Components - Archive of obsolete content
if you update your dependencies in your component, // but forget to remove a dependant library in the stubloader, then we don't want to // fail loading the component since the dependant library isn't required.
Add-ons - Archive of obsolete content
it contains metadata identifying the add-on, providing information about who created it, where more information can be found about it, which versions of what applications it is compatible with, how it should be updated, and so on.
Underscores in class and ID Names - Archive of obsolete content
meyer, netscape communications last updated date: published 05 mar 2001 copyright information: copyright © 2001-2003 netscape.
Case Sensitivity in class and id Names - Archive of obsolete content
meyer, netscape communications last updated date: published 05 mar 2001 copyright information: copyright © 2001-2003 netscape.
DOMSubtreeModified - Archive of obsolete content
document.body.addeventlistener('domsubtreemodified', function () { document.title = 'dom changed at ' + new date(); }, false); ...
cached - Archive of obsolete content
related events checking noupdate downloading progress cached updateready obsolete error ...
error - Archive of obsolete content
related events checking noupdate downloading progress cached updateready obsolete error ...
obsolete - Archive of obsolete content
related events checking noupdate downloading progress cached updateready obsolete error ...
progress - Archive of obsolete content
related events checking noupdate downloading progress cached updateready obsolete error ...
Events - Archive of obsolete content
archived event pages domsubtreemodifiedmozaudioavailablemozbeforeresizemozorientationcachedchargingchangechargingtimechangecheckingdischargingtimechangedownloadingerrorlevelchangenoupdateobsoleteprogressupdateready ...
Install.js - Archive of obsolete content
pros: this version consolidates all the changable information at the top of the file.
Defining Cross-Browser Tooltips - Archive of obsolete content
meyer, netscape communications last updated date: published 16 aug 2002 copyright information: copyright © 2001-2003 netscape.
Images, Tables, and Mysterious Gaps - Archive of obsolete content
meyer last updated date: march 21st, 2003 copyright © 2001-2003 netscape.
Installing plugins to Gecko embedding browsers on Windows - Archive of obsolete content
original document information last updated date: june 18, 2002 copyright information: portions of this content are © 1998–2006 by individual mozilla.org contributors; content available under a creative commons license ...
No Proxy For configuration - Archive of obsolete content
original document information author(s): benjamin chuang last updated date: november 2, 2005 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
How Thunderbird and Firefox find their configuration files - Archive of obsolete content
here is an example of what this may look like: [general] startwithlastprofile=1 [profile0] name=default isrelative=1 path=profiles/default.uda if you want to point this to a location of your choice (for example h:\thunderbird), you need to perform to changes: set isrelative to be 0 update the path to point to the desired place.
Bonsai - Archive of obsolete content
original document information author(s): jamie zawinski last updated date: september 8, 2004 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Adding the structure - Archive of obsolete content
we'll update the value of that attribute each time we retrieve tinderbox's status from the server, and we'll define css rules that change the appearance of the icon depending on the value of that attribute.
install.rdf - Archive of obsolete content
ion> </description> </em:targetapplication> <!-- front end metadata --> <em:name>my_theme</em:name> <em:description>my first theme</em:description> <!-- front end integration hooks (used by theme manager)--> <em:creator>john johnson</em:creator> <em:contributor>john johnson</em:contributor> <em:homepageurl>https://mycoolskin.com/</em:homepageurl> <em:updateurl>https://mycoolskin.com/</em:updateurl> <em:abouturl>https://mycoolskin.com/</em:abouturl> <em:internalname>my_theme</em:internalname> </description> </rdf> ...
Getting Started - Archive of obsolete content
if you have the wrong number here, after you install the skin and select it in the list, it will give you a message saying that it's out of date.
Creating a Skin for Mozilla - Archive of obsolete content
organizing images adding an image to the right of a toolbar jar file installer utility (provided by neil marshall) frequently asked questions links original document information author: neil marshall other contributors (suggestions/corrections): brent marshall, cdn (http://themes.mozdev.org), jp martin, boris zbarsky, asa dotzler, wesayso, david james, dan mauch last updated date: jan 5th, 2003 copyright information: copyright 2002-2003 neil marshall, permission given to devmo to migrate into the wiki april 2005 via email.
Installing Dehydra - Archive of obsolete content
cd $home hg clone http://hg.mozilla.org/mozilla-central/ cd mozilla-central hg update aurora_base_20110705 cd js/src autoconf-2.13 mkdir $home/obj-js cd $home/obj-js $home/mozilla-central/js/src/configure --enable-optimize --disable-debug make it has to be checked whether later/newer branches (like aurora_base_20120131) are working, too.
JSS build instructions for OSX 10.6 - Archive of obsolete content
eloper.mozilla.org/en/nss_reference/building_and_installing_nss/build_instructions https://developer.mozilla.org/jss_build_4.3.html ftp://ftp.mozilla.org/pub/mozilla.org/ <componente> /releases http://www.mozilla.org/projects/secu...using_jss.html steps: export all this: build_opt="1" cvsroot=":pserver:anonymous@cvs-mirror.mozilla.org:/cvsroot" java_home=$(/usr/libexec/java_home") no_mdupdate="1" nsdistmode="copy" ns_use_gcc="1" create working dir: mkdir nss-jss cd nss-jss obtain source: altought manual said nspr_4_6_4_rtm, nss_3_11_4_rtm, jss_4_2_5_rtm, they didnt work for osx, giving many compiling errors.
Repackaging Firefox - Archive of obsolete content
using an extension makes it far easier to keep track of your changes easily when the time comes to upgrade to new versions of firefox, and also ensures, when set-up correctly, that users are able to safely receive firefox updates from mozilla.
Style System Overview - Archive of obsolete content
(but beware didsetstylecontext) the style system style sheets & rules ↓ rule tree ↓ style context interface original document information author(s): david baron last updated date: june 6, 2003 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Firefox - Archive of obsolete content
out-of-date information about the firefox project.
Gecko Coding Help Wanted - Archive of obsolete content
original document information author(s): fantasai last updated date: may 4, 2004 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
CRMF Request object - Archive of obsolete content
avoid using it and update existing code if possible; see the compatibility table at the bottom of this page to guide your decision.
generateCRMFRequest() - Archive of obsolete content
avoid using it and update existing code if possible; see the compatibility table at the bottom of this page to guide your decision.
importUserCertificates - Archive of obsolete content
avoid using it and update existing code if possible; see the compatibility table at the bottom of this page to guide your decision.
popChallengeResponse - Archive of obsolete content
avoid using it and update existing code if possible; see the compatibility table at the bottom of this page to guide your decision.
slideBar - Archive of obsolete content
about status: in development instantiation: jetpack.future.import('slidebar') last update: v0.6 summary: slidebar is a reinvention of the old sidebar feature of browsers.
Mac OS X Build Prerequisites/fink - Archive of obsolete content
$ sudo apt-get update $ sudo apt-get install orbit orbit-dev glib autoconf-2.13 using fink.
Makefile.mozextension.2 - Archive of obsolete content
</version> <description>$(project_desc)</description> <creator>$(project_author)</creator> <contributor>here is a place for you who helped me</contributor> <homepageurl>http://$(project).mozdev.org/</homepageurl> <optionsurl>chrome://$(project)/content/settings.xul</optionsurl> <abouturl>chrome://$(project)/content/about.xul</abouturl> <iconurl>chrome://$(project)/skin/mainicon.png</iconurl> <updateurl>http://$(project).mozdev.org/update.rdf</updateurl> <type>2</type> <targetapplication> <description> <id>{ec8030f7-c20a-464f-9b0e-13a3a9e97384}</id> <minversion>2.0</minversion> <maxversion>9.0</maxversion> </description> </targetapplication> </description> </rdf> endef export install_rdf install.rdf: @echo generating $(project)/install.rdf @echo "$$install_rdf" > $(proje...
Message Summary Database - Archive of obsolete content
this includes a set of per-message flags, the more commonly used headers (e.g., subject, sender, from, to, cc, date, etc), and a few other attributes, e.g., keywords.
New Security Model for Web Services - Archive of obsolete content
) return pr_true if access granted else pr_false void invalidatecache(in string atransporturi); invalidate cached entry for the given transport uri.
Plug-n-Hack Phase1 - Archive of obsolete content
there’s another (possibly out of date) example here.
Porting NSPR to Unix Platforms - Archive of obsolete content
tt> <tt>cvar2</tt> <tt>./join -d</tt> <tt>perf</tt> <tt>./switch -d</tt> <tt>intrupt -d</tt> for i/o: <tt>cltsrv -d</tt>, <tt>cltsrv -gd</tt> <tt>socket</tt> <tt>testfile -d</tt> <tt>tmocon -d</tt> '<tt>tmoacc -d</tt>' in conjunction with '<tt>writev -d</tt>' miscellaneous: <tt>dlltest -d</tt> <tt>forktest</tt> original document information author: larryh@netscape.com last updated date: 16 july 1998 ...
BlogPosts - Archive of obsolete content
just browsing: mozilla prism update thanscorner: mozilla prism - webrunner with pazzaz mozilla prism - a revolution in web apps thanscorner: mozilla webrunner 0.7 site specific browsers webrunner using webrunner webrunner + gears = offline desktop reader webrunner 0.5 webrunner 0.5 - mac support webrunner 0.5 - linux install webrunner, google reader, and google notebook distraction free gtd - 32+ web app files for online todo lists mozilla webrunner: a one-window, tabless browser with no url bar webrunner becomes prism - a mozilla labs project mozilla labs: prism alex faaborg: prism mozilla prism: bringing web apps to the desktop everyone should use site specific browsers mozilla prism portable (spanish) prism, l'avenir des applications web selon mozilla (french) mozilla prism : bundle...
Extensions - Archive of obsolete content
many archive tools, like 7zip, can edit and update a file in the archive without needing to manually extract it and add it back into the xpi.
New Skin Notes - Archive of obsolete content
when the skin is updated on test/docs, editform textarea should be resizeable in all browsers.
Proxy UI - Archive of obsolete content
unfiled bug: changing proxy mode does not update the menu.
SpiderMonkey coding conventions - Archive of obsolete content
use the spidermonkey c++ coding style page on wikimo which is more up to date and the canonical source.
Static Analysis for Windows Code under Linux - Archive of obsolete content
ac_add_options --enable-debug ac_add_options --disable-optimize ac_add_options --disable-tests ac_add_options --disable-embedding-tests ac_add_options --disable-installer ac_add_options --disable-accessibility ac_add_options --disable-vista-sdk-requirements ac_add_options --disable-updater #change this to where your libidl-config file locate.
String Quick Reference - Archive of obsolete content
right: use nsautostring/nscautostring and nsxpidlstring/nsxpidlcstring // call getstringvalue(nsastring& out); nsautostring value; // 64-character buffer on stack getstringvalue(value); // call getstringvalue(char** out); nsxpidlcstring result; getstringvalue(getter_copies(result)); // result will free automatically original document information author: alec flett last updated date: april 30, 2003 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Supporting private browsing mode - Archive of obsolete content
an extension might wish to do this if it's currently in the middle of an operation that prevents safely turning off private browsing (such as a database update operation, for example).
Table Layout Strategy - Archive of obsolete content
original document information author(s): bernd mielke last updated date: september 27, 2003 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Running Tamarin acceptance tests - Archive of obsolete content
tests complete at 2010-09-28 10:39:26.751797 start date: 2010-09-28 10:38:07.221457 end date : 2010-09-28 10:39:26.751797 test time : 0:01:19.530340 passes : 59291 failures : 0 expected failures : 75 tests skipped : 76 the -f flag tells runtests.py to force recompilation of all the scripts.
Tamarin Build System Documentation - Archive of obsolete content
the smoke test list is constantly updated to contain the most recent failures, most frequent failures, and the newest testcases.
Tamarin Releases - Archive of obsolete content
upcoming release name(s)release datelinks tc next~ april 2009roadmap current release namerelease datelinks tc "mar 2009" a5c9ed928c9603/27/09tamarin-devel announcement prior release name(s)release datelinks tc "feb 2009" a5c9ed928c9602/19/09tamarin-devel announcement tamarin-central rev 703:2cee46be9ce0 12/02/08tamarin-devel announcement ...
Tamarin Roadmap - Archive of obsolete content
the tamarin roadmap is intended to provide visibility into planned features and release dates.
Tamarin - Archive of obsolete content
tamarin acceptance testing instructions on how to validate changes to the tamarin source code.
Using cross commit - Archive of obsolete content
land something simultaneously on the trunk and mozilla_1_8_branch # modify the files (probably by applying the patch) patch -p0 < ~/caret.patch # commit on trunk and branch at once # make sure to use -m "commit message" when doing so tools/cross-commit -m "fix some sort of security bug" layout/base/nscaret.h land something on two other branches that has already landed on the trunk # update to the first branch you want to land on cvs update -rmozilla_1_8_branch layout/base/nscaret.h # modify the files (probably by applying the patch) patch -p0 < ~/caret.patch # commit on all the branches at once # make sure to use -m "commit message" when doing so tools/cross-commit --moz18 --branch mozilla_1_8_0_branch -m "fix some sort of security bug" layout/base/nscaret.h notes note t...
[Deprecated] The Mozilla build VM - Archive of obsolete content
thanks to significant improvements in our build environment setup process, it's much simpler and easier to get set up and stay up to date by starting with building firefox instead.
Venkman Introduction - Archive of obsolete content
warning: the content of this article may be out of date.
Venkman - Archive of obsolete content
related topics javascript, web development, developing mozilla original document information author(s): robert ginda other contributors: doctor unclear last updated date: july 13, 2007 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Mozilla Web Developer Community - Archive of obsolete content
archived devedge newsletters are at http://devedge-temp.mozilla.org/community/news/ feeds recent changes rss feed warning: this feed is updated very often.
XML in Mozilla - Archive of obsolete content
this page is outdated.
Creating XPI Installer Modules - Archive of obsolete content
see also jar packaging the jar file specification original document information author(s): ian oeschger original document: creating new packages for mozilla last updated date: march 8, 2003 copyright information: copyright (c) ian oeschger ...
Mac stub installer - Archive of obsolete content
original document information author(s): samir gehani other contributors: curt patrick last updated date: march 12, 2003 copyright information: copyright (c) samir gehani, curt patrick ...
Unix stub installer - Archive of obsolete content
original document information author(s): samir gehani other contributors: curt patrick last updated date: march 12, 2003 copyright information: copyright (c) samir gehani, curt patrick ...
Windows stub installer - Archive of obsolete content
original document information author(s): samir gehani other contributors: curt patrick last updated date: march 12, 2003 copyright information: copyright (c) samir gehani, curt patrick ...
Install script template - Archive of obsolete content
ozilla.org/projects/plugins/plugin-identifier.html **/ // define some global variables var plugin_file = "npmyplugin.dll"; // this plugin consists of an xpt file because it is scriptable // http://mozilla.org/projects/plugins/scripting-plugins.html var component_file = "npmypluginscriptable.xpt"; var plugin_size = 2000; // (dll file) reserve a little extra so it is not required to update too often var component_size = 10; // (xpi file) reserve a little extra so it is not required to update too often var software_name="cult3d mozilla viewer"; // plids (http://mozilla.org/projects/plugins/plugin-identifier.html) are coined by vendors.
Examples - Archive of obsolete content
the following samples demonstrate some of the principal installation functions in the xpinstall api: file.macalias file.windowsshortcut [install.]adddirectory [install.]addfile installtrigger.installchrome installtrigger.startsoftwareupdate windows install example ...
compareTo - Archive of obsolete content
proceed to update ...
addFile - Archive of obsolete content
method of install object syntax public int addfile ( string registryname, installversion version, string xpisourcepath, object localdirspec, string relativelocalpath, boolean forceupdate); public int addfile ( string registryname, string version, string xpisourcepath, object localdirspec, string relativelocalpath, boolean forceupdate); public int addfile ( string xpisourcepath); public int addfile ( string registryname, string xpisourcepath, object localdirspec, string relativelocalpath); public int addfile ( string registryname, string version, stri...
confirm - Archive of obsolete content
after the user presses a button (or closes the window), the value property is updated according to the checkbox.
Properties - Archive of obsolete content
startsoftwareupdate("http://webserver/argstest.xpi?argument_string") will result in the value of install.arguments being argument_string #).
Return Codes - Archive of obsolete content
in mozilla/seamonkey, these constants are defined as part of the xpinstall object (formerly the softwareupdate object in netscape communicator 4.5).
XPJS Components Proposal - Archive of obsolete content
original document information author: john bandhauer last updated date: 1 july 1999 ...
Mozilla E4X - Archive of obsolete content
another e4x feature: the ability to bind a w3c dom document to a new xml object, reflecting the dom in e4x terms so that updates to either the dom or the e4x object hierarchy show up in the other.
XTech 2005 Presentations - Archive of obsolete content
another e4x feature: the ability to bind a w3c dom document to a new xml object, reflecting the dom in e4x terms so that updates to either the dom or the e4x object hierarchy show up in the other.
XTech 2006 Presentations - Archive of obsolete content
microsummaries in firefox and on the web - myk melez microsummaries are regularly-updated compilations of the most important and timely information on web pages.
allowevents - Archive of obsolete content
for menu, menuseparator, menuitem and treecol elements, as well as menu buttons, and the popup datepicker, mouse events are also retargeted to the element itself.
customindex - Archive of obsolete content
the value is updated automatically by the toolbar customization dialog.
disabled - Archive of obsolete content
visible controls have a disabled property which, except for menus and menuitems, is normally preferred to use of the attribute, as it may need to update additional state.
emptytext - Archive of obsolete content
the old name is retained for compatibility, but you should update your code.
preference-editable - Archive of obsolete content
the element should fire change, command, or input event when the value is changed so that the preference will update accordingly.
state - Archive of obsolete content
this attribute will be updated automatically as the splitter is moved, and is generally used in a stylesheet to apply a different appearance for each state.
statusbar - Archive of obsolete content
« xul reference home statusbar type: id if you set this attribute to the id of a statusbar element, the label on the statusbar will update to the statustext of the items on the menu as the user moves the mouse over them.
textbox.type - Archive of obsolete content
a listener for the command event should update search results.
textbox.value - Archive of obsolete content
to get the updated value, use the value property.
type - Archive of obsolete content
ArchiveMozillaXULAttributetype
see button.type browser.type colorpicker.type datepicker.type editor.type listcell.type listitem.type menuitem.type notification.type prefwindow.type query.type script.type textbox.type toolbarbutton.type treecol.type ...
value - Archive of obsolete content
see also datepicker.value label.value progressmeter.value textbox.value textnode.value timepicker.value where.value ...
width - Archive of obsolete content
<hbox> <hbox width="40" style="background-color: red;"> <label value="40"/> </hbox> </hbox> however, in the following example, despite that the preferred width of the box is 30 pixels, the displayed size of the box will be larger to accommodate the larger label.
Working With Directories - Archive of obsolete content
if the time is higher, the lastmod variable is updated as needed.
IO - Archive of obsolete content
ArchiveMozillaXULFileGuideIO
retrieve a file object for information about getting a file object, see accessing files get information about a file available information about a file include the permissions, size, and last modified date of a file.
getBrowserIndexForDocument - Archive of obsolete content
the returned index is dependent on the tabs in the tabbrowser and is invalidated when the tab ordering changes.
Menus - Archive of obsolete content
<menubar id="sample-menubar"> <menu id="view-menu" label="view"> <menupopup> <menuitem label="toolbar"/> <menuitem label="status bar"/> <menuseparator/> <menu label="sort" accesskey="s"> <menupopup> <menuitem label="by name"/> <menuitem label="by date"/> </menupopup> </menu> </menupopup> </menu> </menubar> in this example, a top level 'view' menu has two child menuitems, a separator and a submenu created with the menu tag.
Special per-platform menu considerations - Archive of obsolete content
checkforupdates the item that opens the update dialog for the application, for applications that have one (such as seamonkey; firefox does not have this item).
currentSet - Archive of obsolete content
be careful, as setting this property doesn't automatically update the currentset attribute.
emptyText - Archive of obsolete content
the old name is retained for compatibility, but you should update your code.
open - Archive of obsolete content
ArchiveMozillaXULPropertyopen
see also colorpicker.open datepicker.open menu.open ...
value - Archive of obsolete content
ArchiveMozillaXULPropertyvalue
see also datepicker.value textbox.value timepicker.value ...
Property - Archive of obsolete content
mand commandmanager completedefaultindex container contentdocument contentprincipal contenttitle contentview contentvieweredit contentviewerfile contentwindow contextmenu control controller controllers crop current currentindex currentitem currentnotification currentpage currentpane currentset currenturi customtoolbarcount database datasources date dateleadingzero datevalue decimalplaces decimalsymbol defaultbutton defaultvalue description dir disableautocomplete disableautocomplete disableautoselect disabled disablekeynavigation dlgtype docshell documentcharsetinfo editable editingcolumn editingrow editingsession editor editortype emptytext deprecated since gecko 2 enablecolumndrag eventno...
Result Generation - Archive of obsolete content
there are two types of nodes in rdf, resources which usually represent 'things', and literals which are values like the names, dates or sizes of those things, and so on.
Special Condition Tests - Archive of obsolete content
of course, we will need to update the predicates and labels to retrieve the right data.
Template Builder Interface - Archive of obsolete content
due to the nature of the way templates are updated, you don't usually need to rebuild a template after a refresh call, although there may situtations where this will be necessary.
The Joy of XUL - Archive of obsolete content
the calendar application is comprised of a xul front end and an xpcom component that leverages libical, a native library written in c, for date operations and calendar data storage.
Complete - Archive of obsolete content
for more information about version checks, see: extension versioning, update and compatibility the installed jar to use disk space efficiently on the end user's computer, the three directories (content, locale, skin) are packed in a jar file.
Custom toolbar button - Archive of obsolete content
supported applications you can use the steps on this page with any or all of these mozilla applications: firefox 1.5 or a later version seamonkey 2.0 or a later version thunderbird 1.5 or a later version sunbird 0.3 or a later version pre-release versions of these (alphas, betas and release candidates) are also ok.
Tree Widget Changes - Archive of obsolete content
the invalidateprimarycell(row) method has been removed, instead use nsitreeboxobject.invalidatecell() like this invalidatecell(row, tree.columns.getprimarycolumn()).
Adding Style Sheets - Archive of obsolete content
<spacer class="titlespace"/> <groupbox orient="horizontal"> <caption label="search criteria"/> <menulist id="searchtype"> <menupopup> <menuitem label="name"/> <menuitem label="size"/> <menuitem label="date modified"/> </menupopup> </menulist> <spacer class="springspace"/> <menulist id="searchmode"> <menupopup> <menuitem label="is"/> <menuitem label="is not"/> </menupopup> </menulist> <spacer class="springspace"/> <menulist id="find-text" flex="1" editable="true" datasources="file:///mozilla/recents.
Box Objects - Archive of obsolete content
for example, a flexible element will change in size and the box object dimensions will update accordingly.
Creating a Skin - Archive of obsolete content
« previousnext » this documentation has not updated for firefox quantum.
Creating a Wizard - Archive of obsolete content
this allows you to validate the input entered on each page before the user continues.
Modifying the Default Skin - Archive of obsolete content
this documentation has not been fully updated for firefox quantum.
Tabboxes - Archive of obsolete content
</description> <spacer style="height: 10px"/> <groupbox orient="horizontal"> <caption label="search criteria"/> <menulist id="searchtype"> <menupopup> <menuitem label="name"/> <menuitem label="size"/> <menuitem label="date modified"/> </menupopup> </menulist> <spacer style="width: 10px;"/> <menulist id="searchmode"> <menupopup> <menuitem label="is"/> <menuitem label="is not"/> </menupopup> </menulist> <spacer style="height: 10px"/> <textbox id="find-text" flex="1" style="min-width: 15em;"/> </groupbox> </tabpanel> <tabpanel...
Templates - Archive of obsolete content
you'll notice that the buttons in the example get updated instantly.
The Chrome URL - Archive of obsolete content
if you were to move the file messenger.jar somewhere else and update the manifest file accordingly, thunderbird will still work since it doesn't rely on its specific installed location.
XBL Attribute Inheritance - Archive of obsolete content
in addition, changing the value of the attributes on the searchbox with a script will update the textbox and button also.
XBL Example - Archive of obsolete content
in addition, the text widget will need to be updated to display which page is the current one.
Using nsIXULAppInfo - Archive of obsolete content
cu.import("resource://testing-common/appinfo.jsm"); updateappinfo(); older versions as stated above, older mozilla 1.7-based applications do not support nsixulappinfo.
Writing Skinnable XUL and CSS - Archive of obsolete content
original document information author(s): david hyatt last updated date: may 24, 2000 copyright information: copyright (c) 1999-2000 david hyatt ...
XULBrowserWindow - Archive of obsolete content
the xulbrowserwindow object provides methods and properties that let the browser update the user interface of the enclosing xul window.
XUL element attributes - Archive of obsolete content
the element should fire change, command, or input event when the value is changed so that the preference will update accordingly.
XUL accessibility guidelines - Archive of obsolete content
testing human computer interaction ensure that help documentation is up to date.
XML - Archive of obsolete content
oeschger last updated date: november 13, 2001 copyright information: copyright (c) ian t.
XUL Coding Style Guidelines - Archive of obsolete content
author: tao cheng newsgroup discussion mailing list original document information author(s): tao cheng last updated date: december 10, 2004 copyright information: copyright (c) tao cheng ...
XUL Event Propagation - Archive of obsolete content
original author: ian oeschger other documents: w3c dom events, mozilla xul events original document information author(s): ian oeschger last updated date: january 18, 2002 copyright information: copyright (c) ian oeschger ...
arrowscrollbox - Archive of obsolete content
visible controls have a disabled property which, except for menus and menuitems, is normally preferred to use of the attribute, as it may need to update additional state.
broadcaster - Archive of obsolete content
if the label changes, the labels of the observers will update automatically.
button - Archive of obsolete content
visible controls have a disabled property which, except for menus and menuitems, is normally preferred to use of the attribute, as it may need to update additional state.
checkbox - Archive of obsolete content
visible controls have a disabled property which, except for menus and menuitems, is normally preferred to use of the attribute, as it may need to update additional state.
colorpicker - Archive of obsolete content
visible controls have a disabled property which, except for menus and menuitems, is normally preferred to use of the attribute, as it may need to update additional state.
command - Archive of obsolete content
visible controls have a disabled property which, except for menus and menuitems, is normally preferred to use of the attribute, as it may need to update additional state.
description - Archive of obsolete content
visible controls have a disabled property which, except for menus and menuitems, is normally preferred to use of the attribute, as it may need to update additional state.
dropmarker - Archive of obsolete content
for instance the menulist and the popup type of datepicker use a dropmarker, that when pressed, will reveal a popup menu.
key - Archive of obsolete content
ArchiveMozillaXULkey
visible controls have a disabled property which, except for menus and menuitems, is normally preferred to use of the attribute, as it may need to update additional state.
keyset - Archive of obsolete content
visible controls have a disabled property which, except for menus and menuitems, is normally preferred to use of the attribute, as it may need to update additional state.
label - Archive of obsolete content
ArchiveMozillaXULlabel
visible controls have a disabled property which, except for menus and menuitems, is normally preferred to use of the attribute, as it may need to update additional state.
listbox - Archive of obsolete content
visible controls have a disabled property which, except for menus and menuitems, is normally preferred to use of the attribute, as it may need to update additional state.
listcell - Archive of obsolete content
visible controls have a disabled property which, except for menus and menuitems, is normally preferred to use of the attribute, as it may need to update additional state.
listhead - Archive of obsolete content
visible controls have a disabled property which, except for menus and menuitems, is normally preferred to use of the attribute, as it may need to update additional state.
listheader - Archive of obsolete content
visible controls have a disabled property which, except for menus and menuitems, is normally preferred to use of the attribute, as it may need to update additional state.
listitem - Archive of obsolete content
visible controls have a disabled property which, except for menus and menuitems, is normally preferred to use of the attribute, as it may need to update additional state.
menu - Archive of obsolete content
ArchiveMozillaXULmenu
visible controls have a disabled property which, except for menus and menuitems, is normally preferred to use of the attribute, as it may need to update additional state.
menubar - Archive of obsolete content
statusbar type: id if you set this attribute to the id of a statusbar element, the label on the statusbar will update to the statustext of the items on the menu as the user moves the mouse over them.
menuseparator - Archive of obsolete content
visible controls have a disabled property which, except for menus and menuitems, is normally preferred to use of the attribute, as it may need to update additional state.
prefpane - Archive of obsolete content
void userchangedvalue(in domelement element); the user changed the value in a widget that the preferences system does not automatically track state changes for (1) and the preference element associated with the widget should be updated based on the state held by the widget.
radio - Archive of obsolete content
ArchiveMozillaXULradio
visible controls have a disabled property which, except for menus and menuitems, is normally preferred to use of the attribute, as it may need to update additional state.
radiogroup - Archive of obsolete content
visible controls have a disabled property which, except for menus and menuitems, is normally preferred to use of the attribute, as it may need to update additional state.
richlistbox - Archive of obsolete content
visible controls have a disabled property which, except for menus and menuitems, is normally preferred to use of the attribute, as it may need to update additional state.
richlistitem - Archive of obsolete content
visible controls have a disabled property which, except for menus and menuitems, is normally preferred to use of the attribute, as it may need to update additional state.
scale - Archive of obsolete content
ArchiveMozillaXULscale
visible controls have a disabled property which, except for menus and menuitems, is normally preferred to use of the attribute, as it may need to update additional state.
spinbuttons - Archive of obsolete content
for instance, spinbuttons are used for the number type textbox, and with the timepicker and datepicker.
tabbrowser - Archive of obsolete content
the returned index is dependent on the tabs in the tabbrowser and is invalidated when the tab ordering changes.
tabs - Archive of obsolete content
ArchiveMozillaXULtabs
visible controls have a disabled property which, except for menus and menuitems, is normally preferred to use of the attribute, as it may need to update additional state.
window - Archive of obsolete content
note: when a window is minimized, the sizemode attribute is not updated.
XULRunner 1.8.0.1 Release Notes - Archive of obsolete content
xulrunner 1.8.0.4 is now available as a security/stability update; all users should install this new version.
XULRunner 2.0 Release Notes - Archive of obsolete content
specific runtimes can be found at: download xulrunner for windows download xulrunner for mac os x download xulrunner for 32-bit linux download xulrunner for 64-bit linux (warning: links may become out-of-date at times).
Building XULRunner with Python - Archive of obsolete content
axpcom ac_add_options --disable-activex ac_add_options --disable-activex-scripting ac_add_options --disable-tests ac_add_options --enable-optimize to check out all the required source code and build it the first time with no local client.mk file, execute cd /c/projects cvs -d :pserver:anonymous@cvs-mirror.mozilla.org:/cvsroot co mozilla/client.mk cd mozilla make -f client.mk for subsequent updates from cvs followed by a build, use cd /c/projects/mozilla make -f client.mk which will also checkout client.mk itself for build only, without checkouts, use make -f client.mk build and see client.mk for other options.
Creating a Windows Inno Setup installer for XULRunner applications - Archive of obsolete content
[setup] appname=my app appvername=my app 1.0 apppublisher=mark finkle apppublisherurl=http://developer.mozilla.org/en/docs/getting_started_with_xulrunner appsupporturl=http://developer.mozilla.org/en/docs/getting_started_with_xulrunner appupdatesurl=http://developer.mozilla.org/en/docs/getting_started_with_xulrunner defaultdirname={pf}\my app defaultgroupname=my app allownoicons=yes outputdir=..\build\output outputbasefilename=myapp-1.0-win32 ; setupiconfile= compression=lzma solidcompression=yes [languages] name: english; messagesfile: compiler:default.isl [components] name: main; description: my app; types: full compact custom; flags...
Debugging a XULRunner Application - Archive of obsolete content
if .autoreg already exists, then edit it to force the last modified time to be updated.
Deploying XULRunner - Archive of obsolete content
other executables and libraries the core changes to xul and gecko that require this new file layout were implemented in gecko 34, except that the xulrunner application was not updated to know about the change, so it will report an error: "unable to load xpcom." xulrunner was fixed in gecko 39.
Dialogs in XULRunner - Archive of obsolete content
see also dialog xul tutorial:creating dialogs nsifilepicker xul tutorial:open and save dialogs « previous original document information author: mark finkle last updated date: october 2, 2006 ...
Getting started with XULRunner - Archive of obsolete content
you need to move your existing chrome.manifest to the application root folder, remembering to update the relative paths within the file.
How to enable locale switching in a XULRunner application - Archive of obsolete content
code to update the locale user preference and restart the application mozilla xulrunner doesn't allow runtime switching of the locale, therefore the application must be restarted to activate the new choice.
Make your xulrunner app match the system locale - Archive of obsolete content
please update if there are more correct ways to do this.
XULRunner tips - Archive of obsolete content
irm.xul"); pref("xpinstall.dialog.progress.skin", "chrome://mozapps/content/extensions/extensions.xul?type=themes"); pref("xpinstall.dialog.progress.chrome", "chrome://mozapps/content/extensions/extensions.xul?type=extensions"); pref("xpinstall.dialog.progress.type.skin", "extension:manager-themes"); pref("xpinstall.dialog.progress.type.chrome", "extension:manager-extensions"); pref("extensions.update.enabled", true); pref("extensions.update.interval", 86400); pref("extensions.dss.enabled", false); pref("extensions.dss.switchpending", false); pref("extensions.ignoremtimechanges", false); pref("extensions.logging.enabled", false); pref("general.skins.selectedskin", "classic/1.0"); // nb these point at amo pref("extensions.update.url", "chrome://mozapps/locale/extensions/extensions.properties");...
What XULRunner Provides - Archive of obsolete content
the following features are either already implemented or planned: gecko features xpcom networking gecko rendering engine dom editing and transaction support (no ui) cryptography xbl (xbl2 planned) xul svg xslt xml extras (xmlhttprequest, domparser, etc.) web services (soap) auto-update support (not yet complete) type ahead find toolbar history implementation (the places implementation in the 1.9 cycle) accessibility support ipc services for communication between gecko-based apps (not yet complete) storage/sqlite interfaces user interface features the following user interface is supplied by xulrunner, and may be overridden by embedders under certain circumstances: ...
Windows and menus in XULRunner - Archive of obsolete content
see also xul:windows xul tutorial:creating a window commandset command xul tutorial:commands xul tutorial:simple menu bars xul tutorial:toolbars « previousnext » original document information author: mark finkle last updated date: october 2, 2006 ...
XUL Application Packaging - Archive of obsolete content
this is typically a date identifier, and should be different for every released version of an application.
xulauncher - Archive of obsolete content
e.manifest" xulprefs="$wd/$xulname/defaults/preferences/prefs.js" # make minimal directory structure ############################################################################## mkdir -p $xuldir mkdir -p $xulprefdir # create application.ini file ############################################################################## echo " [app] vendor=xulauncher.sh name=$xulname version=0.0.1 buildid=`date +%y%m%d` [gecko] minversion=1.8 maxversion=1.9 ">$xulappini # create chrome.manifest file ############################################################################## echo " content $xulname file:$xulname/ ">$xulmanifest # create prefs.js file ############################################################################## echo " pref(\"toolkit.defaultchromeuri\", \"chrome://$xulname/content/$...
XULRunner - Archive of obsolete content
debug documentation steps to configure venkman to debug your app xulrunner guide a fairly complete, but outdated, introduction and tutorial for xulrunner which collates much of the documentation found here.
Archived Mozilla and build documentation - Archive of obsolete content
porting nspr to unix platforms last modified 16 july 1998 priority content update: i've removed documents from this list that have been migrated into the wiki.
Mozilla.dev.apps.firefox-2006-10-06 - Archive of obsolete content
a wiki has been set up aswell as weekly meetings, and a face-to-face meeting will be scheduled at a later date.
2006-11-10 - Archive of obsolete content
important dates: technical submissions: monday 19th feb 2007 technical paper notification: friday 16th march 2007 communication submissions: monday 26th march 2007 communication paper notification: friday 06th april 2007 all camera ready due: monday 16th april 2007 conference dates: monday 07th and tuesday 08th may 2007 notable keynotes representatives from w3c, ibm, university of manchester, uk and oxford br...
2006-11-22 - Archive of obsolete content
summary: mozilla.dev.accessibility - nov 17-nov 22, 2006 announcements mozilla osk project grant aaron leventhal (on behalf of michael curran) mentiond that there is now an nvda email list you can join if you wish to keep up to date with the latest changes, or if you wish to discuss new features or talk with other nvda users.
2006-10-06 - Archive of obsolete content
summary: mozilla.dev.apps.calendar - september 29 - october 6, 2006 announcements sunbird and lightning 0.3rc1 available gordon announced the candidate (rc) builds for sunbird and lightning 0.3 are released.
2006-10-06 - Archive of obsolete content
a wiki has been set up aswell as weekly meetings, and a face-to-face meeting will be scheduled at a later date.
2006-10-13 - Archive of obsolete content
firefox add-on wanted user is inquiring if there is such an application to automatically save pieces of a webpage everytime is it updated.
2006-10-13 - Archive of obsolete content
summary: mozilla.dev.apps.thunderbird - october 7-13, 2006 announcements updated: thunderbird developer documentation eric shepherd has put together a checklist for the upcoming thunderbird developer documentation and is looking for feedback as well as contributors.
2006-10-20 - Archive of obsolete content
discussions how to use the tb/ab lastmodifieddate item and how to solve the problem regarding to this item.
2006-12-01 - Archive of obsolete content
announcements automatic configure updated back on november 27th j.
2006-11-24 - Archive of obsolete content
final release date in in early 2007.
2006-09-22 - Archive of obsolete content
announcements l10n firefox 2.0 rc1 builds available paul reed announced the availability of firefox 2 rc1 l10n builds 'major update' test paul reed made a test of the 'major update' feature available on sept.
2006-10-13 - Archive of obsolete content
10; the target release date for rc3 is october 17 new tinderbox and bonsai servers the build team would like help testing out the new tinderbox and bonsai servers.
2006-10-20 - Archive of obsolete content
firefox 2 release candidate 3 is now available for download ff2 rc3 available for download.
2006-11-24 - Archive of obsolete content
announcments bon echo status mike beltzner posted a small to-do list with regards to bon echo firefox 1.5.0.9/2.0.0.1 jay patel posted an update of bugs for the firefox 1.5.0.9/2.0.0.1 releases discussion non-ascii rendering performance boris zbarsky made some suggestions on how to improve international font rendering cvs commit access changes a large discussion went on about changes to policies surrounding cvs commit access project drivers and technical oversight mike connor suggested ways to better organize project management, policy making, and technical oversight.
2006-09-29 - Archive of obsolete content
summary of newsgroup moz.dev.platform summary: mozilla.dev.platform - september 22 - 29, 2006 announcements firefox 2 release candidate 1 is now available for download announcing that firefox 2 rc 1 is available for download discussions xulrunner fails without feedback on osx intel 10.4.7 will morton is trying to port a xul application to osx.
2006-10-20 - Archive of obsolete content
there are a few concerns with the software updates, and a decision is required on this before a "go" for rc3 release can be given.
2006-11-24 - Archive of obsolete content
robcee, rhelmer, and bsmedberg are the possible candidates.
2006-11-17 - Archive of obsolete content
discussions how to detect firefox updates externally?
mozilla-dev-tech-js-engine - Archive of obsolete content
2006-09-22 2006-09-29 2006-10-06 2006-10-13 2006-10-20 *no updates see faq instead 2006-10-27 *no updates see faq instead 2006-11-03 2006-11-10 2006-11-17 2006-11-24 2006-12-01 js-engine faq ...
2006-11-24 - Archive of obsolete content
discussions backed out view manager hierarchy unification discussion aboutthe view manager hierarchy unification and the problems with tp regressions that occuring whenever update batching interacts it.
2006-10-27 - Archive of obsolete content
discussions evalinsandbox and xmlhttprequest a discussion about writing something that calls a function defined by the page that the user is currently on chrome files and last modified date ways to retrieve the last modified date of a chrome file that may be in a jar or on the file system.
2006-11-10 - Archive of obsolete content
summary: mozilla.dev.tech.xpcom - oct 04-nov 10, 2006 announcements xptcall changes in process - ports owners needed if you maintain an xptcall port, you are needed to submit a patch to that bug 349002 with xptcall updates.
2006-10-13 - Archive of obsolete content
summary: mozilla.dev.apps.calendar - october 6 - october 13, 2006 announcements sunbird and lightning 0.3rc2 available matthew willis announced the second release candidate builds for sunbird and lightning 0.3 are released.
2006-10-20 - Archive of obsolete content
problem with creating / updating / exporting events how to add/update events in "home" calendar meetings planning the next calendar release meet regarding the views of next calendar release.
2006-10-27 - Archive of obsolete content
summary: mozilla.dev.apps.calendar - october 20 - october 27, 2006 announcements calendar test day october 31st a test date has been set for october 31st.
Browser-side plug-in API - Archive of obsolete content
npn_destroystream npn_forceredraw npn_getauthenticationinfo npn_geturl npn_geturlnotify npn_getvalue npn_getvalueforurl npn_invalidaterect npn_invalidateregion npn_memalloc npn_memflush npn_memfree npn_newstream npn_pluginthreadasynccall npn_poppopupsenabledstate npn_posturl npn_posturlnotify npn_pushpopupsenabledstate npn_reloadplugins npn_requestread npn_setvalue npn_setvalueforurl npn_status npn_useragent npn_version npn_write ...
NPN_GetValue - Archive of obsolete content
nvnetscapewindow: ms windows and unix/x11 only: ms windows: gets the native window on which plug-in drawing occurs; returns hwnd unix/x11: gets the browser toplevel window in which the plug-in is displayed; returns window npnvjavascriptenabledbool: tells whether javascript is enabled; true=javascript enabled, false=not enabled npnvasdenabledbool: tells whether smartupdate (former name: asd) is enabled; true=smartupdate enabled, false=not enabled npnvisofflinebool: tells whether offline mode is enabled; true=offline mode enabled, false=not enabled npnvtoolkit: npnvsupportsxembedbool: npnvwindownpobject: returns the npobject * pointer for the dom window object; see getting the page url in npapi plugin for a rough example npnvpluginelementnpobject: ...
Samples and Test Cases - Archive of obsolete content
there are plans to clean up the sample plugin situation - better organization, updated build systems, get them building on all platforms.
Supporting private browsing in plugins - Archive of obsolete content
plugins should be updated to monitor the state of private browsing mode and only save private information when private browsing is disabled.
Why use RSS - Archive of obsolete content
people are using it to syndicate all sorts of things: news articles, blogs, bookmarks, internet radio shows, internet television shows, software updates, e-mails, mailing lists, music playlists, and more.
Module - Archive of obsolete content
name common prefix status release date author atomic rss atom july 27, 2005 tim bray blogchannel september 17, 2002 dave winer content content creativecommons cc december 16, 2002 dave winer dublin core dc slash slash well-formed web wfw joe gregorio and chris ...
0.90 - Archive of obsolete content
ArchiveRSSVersion0.90
<title>mozilla dot org</title> <link>http://www.mozilla.org</link> <description>the mozilla organization web site</description> </channel> <image> <title>mozilla</title> <url>http://www.mozilla.org/images/moz.gif</url> <link>http://www.mozilla.org</link> </image> <item> <title>new status updates</title> <link>http://www.mozilla.org/status/</link> </item> <item> <title>bugzilla reorganized</title> <link>http://www.mozilla.org/bugs/</link> </item> <item> <title>mozilla party, 2.0!</title> <link>http://www.mozilla.org/party/1999/</link> </item> <item> <title>unix platf...
Version - Archive of obsolete content
name status release date based on author rss 0.90 march 1999 rdf netscape netscape's rss 0.91 (revision 1) ?
Element - Archive of obsolete content
d <day> (rss day element) <description> (rss description element) <docs> (rss docs element) e <enclosure> (rss enclosure element) f g <generator> (rss generator element) <guid> (rss guid element) h <height> (rss height element) <hour> (rss hour element) i <image> (rss image element) <item> (rss item element) j k l <language> (rss language element) <lastbuilddate> (rss last build date element) <link> (rss link element) m <managingeditor> (rss managing editor element) n <name> (rss name element) o p <pubdate> (rss published date element) q r <rating> (rss rating element) <rss> (rss's root "rss" element) s <skipdays> (rss skip days element) <skiphours> (rss skip hours element) <source> (rss source element) t <textinput> (...
Confidentiality, Integrity, and Availability - Archive of obsolete content
original document information author(s): karen scarfone, wayne jansen, and miles tracy title: nist special publication 800-123, guide to general server security last updated date: july 2008 copyright information: this document is not subject to copyright.
Encryption and Decryption - Archive of obsolete content
original document information author(s): ella deon lackey last updated date: 2012 copyright information: © 2012 red hat, inc.
SSL and TLS - Archive of obsolete content
original document information author(s): ella deon lackey last updated date: 2012 copyright information: © 2012 red hat, inc.
TCP/IP Security - Archive of obsolete content
original document information author(s): sheila frankel, paul hoffman, angela orebaugh, and richard park title: national institute of standards and technology (nist) special publication 800-113, guide to ssl vpns last updated date: july 2008 copyright information: this document is not subject to copyright.
Table Reflow Internals - Archive of obsolete content
original document information author(s): chris karnaze last updated aug 7, 2002 ...
install.rdf - Archive of obsolete content
_ff_version</em:minversion> <em:maxversion>max_ff_version</em:maxversion> </description> </em:targetapplication> <!-- front end metadata --> <!-- my_theme --> <em:name>my_theme</em:name> <em:description>my_theme</em:description> <em:creator>your_name</em:creator> <em:contributor>contributors_names</em:contributor> <em:homepageurl>themes_homepage</em:homepageurl> <em:updateurl> url_of_update_location </em:updateurl> <em:abouturl> url_of_about_page </em:abouturl> <!-- front end integration hooks (used by theme manager)--> <em:internalname>my_theme</em:internalname> </description> </rdf> ...
Using IO Timeout And Interrupt On NT - Archive of obsolete content
original document information author: larryh@netscape.com last updated date: december 1, 2004 ...
Using SSH to connect to CVS - Archive of obsolete content
if you wish to keep your previous pserver trees, you'll need to update the root files in each cvs subdirectory in your tree.
Summary of Changes - Archive of obsolete content
this section outlines all of the element and practice updates described in this article.
Using Web Standards in your Web Pages - Archive of obsolete content
contents benefits of using web standards making your page using web standards - how to using the w3c dom developing cross browser and cross platform pages using xmlhttprequest summary of changes references original document information author(s): mike cowperthwaite, marcio galli, jim ley, ian oeschger, simon paquet, gérard talbot last updated date: may 29, 2008 copyright information: portions of this content are © 1998–2008 by individual mozilla.org contributors; content available under a creative commons license | details.
-moz-stack-sizing - Archive of obsolete content
/* keyword values */ -moz-stack-sizing: auto; -moz-stack-sizing: ignore; /* global values */ -moz-stack-sizing: inherit; -moz-stack-sizing: initial; -moz-stack-sizing: unset; if you wish to prevent the stack from resizing automatically to accommodate its children, you can set -moz-stack-sizing to ignore on the child element.
::-ms-clear - Archive of obsolete content
such inputs include: <input type="color"> <input type="date"> <input type="datetime"> <input type="datetime-local"> <input type="email"> <input type="month"> <input type="number"> <input type="search"> <input type="tel"> <input type="time"> <input type="url"> <input type="week"> allowable properties only the following css properties can be used in a rule with ::-ms-clear in its selector.
display-inside - Archive of obsolete content
candidate recommendation initial specification browser compatibility not supported in any browser.
display-outside - Archive of obsolete content
candidate recommendation initial definition ...
CSS - Archive of obsolete content
ArchiveWebCSS
-lines css property is a microsoft extension specifying the maximum number of consecutive lines in an element that may be ended with a hyphenated word.-ms-hyphenate-limit-zonethe -ms-hyphenate-limit-zone css property is a microsoft extension specifying the width of the hyphenation zone.-ms-ime-alignthe -ms-ime-align css property is a microsoft extension aligning the input method editor (ime) candidate window box relative to the element on which the ime composition is active.
Debug - Archive of obsolete content
debug.msupdateasynccallbackrelation updates the relationship status between a synchronous work item and the associated asynchronous operation.
Microsoft JavaScript extensions - Archive of obsolete content
objects activexobject debug enumerator vbarray functions getobject scriptengine scriptenginebuildversion scriptenginemajorversion scriptengineminorversion statements @cc-on @if @set other date.getvardate() error.description error.number error.stacktracelimit ...
New in JavaScript 1.8.1 - Archive of obsolete content
javascript 1.8.1 is a modest update syntactically to javascript; the main change in this release is the addition of the tracemonkey just-in-time compiler, which improves performance.
ECMAScript 2015 support in Mozilla - Archive of obsolete content
r.parsefloat() (firefox 25) number.epsilon (firefox 25) number.max_safe_integer, number.min_safe_integer (firefox 31) number.issafeinteger() (firefox 32) additions to the object object object.prototype.__proto__ has been standardized object.is() (firefox 22) object.setprototypeof() (firefox 31) object.assign() (firefox 34) object.getownpropertysymbols() (firefox 33) additions to the date object date.prototype is an ordinary object (firefox 41) generic date.prototype.tostring (firefox 41) date.prototype[@@toprimitive] (firefox 44) new promise object promise (firefox 24, enabled by default in firefox 29) new proxy object proxy (firefox 18) preventextensions() trap (firefox 22) isextensible() trap (firefox 31) getprototypeof() and setprototypeof() traps (firefox 49...
ECMAScript 5 support in Mozilla - Archive of obsolete content
gecko 1.9.1.4 updated the implementation of json.stringify() to be compliant with ecmascript 5.
Object.unobserve() - Archive of obsolete content
erve(obj, observer); ​ obj.newproperty = 2; // [{name: 'newproperty', object: <obj>, type: 'add'}] object.unobserve(obj, observer); obj.foo = 1; // the callback wasn't called using an anonymous function var person = { name: 'ahmed', age: 25 }; object.observe(person, function(changes) { console.log(changes); }); person.age = 40; // [{name: 'age', object: <obj>, oldvalue: 25, type: 'update'}] object.unobserve(person, function(changes) { console.log(changes); }); person.age = 63; // [{name: 'age', object: <obj>, oldvalue: 40, type: 'update'}] // the callback will always be called specifications not part of any standard.
Object.prototype.watch() - Archive of obsolete content
examples using watch and unwatch const o = { p: 1 }; o.watch('p', (id, oldval, newval) => { console.log('o.' + id + ' changed from ' + oldval + ' to ' + newval); return newval; }); o.p = 2; o.p = 3; delete o.p; o.p = 4; o.unwatch('p'); o.p = 5; this script displays the following: o.p changed from 1 to 2 o.p changed from 2 to 3 o.p changed from undefined to 4 using watch() to validate an object's properties you can use watch to test any assignment to an object's properties.
LiveConnect Overview - Archive of obsolete content
(although this functionality (along with some others) had been broken in gecko 1.9 (see bug 391642) as the mozilla-specific liveconnect code had not been maintained inside mozilla, with java 6 update 11 and 12 building support for reliance on mozilla's implementation of the generic (and cross-browser) npapi plugin code, this has again been fixed.) for example, suppose you are using the java forname method to assign the name of a java class to a variable called theclass.
Properly Using CSS and JavaScript in XHTML Documents - Archive of obsolete content
see also writing javascript for xhtml original document information author(s): bob clary last updated date: march 14th, 2003 copyright © 2001-2003 netscape.
Styling the Amazing Netscape Fish Cam Page - Archive of obsolete content
- related links the amazing netscape fish cam page original document information author(s): eric meyer, standards evangelist, netscape communications last updated date: published 25 apr 2003 copyright information: copyright © 2001-2003 netscape.
XForms Custom Controls Examples - Archive of obsolete content
var val = this.stringvalue; var newdom = this.domparser.parsefromstring(val, "text/xml"); var impnode = document.importnode(newdom.firstchild, true); // get content node, clean it, and update it var content = document.getanonymouselementbyattribute(this, "anonid", "content"); if (content.firstchild) { content.removechild(content.firstchild); } content.appendchild(impnode); return true; </body> </method> </implementation> </binding> ...
RFE to the Custom Controls Interfaces - Archive of obsolete content
in short, we have the following interfaces: nsixformsaccessors - serves to get/set the value of the instance data node that the xforms element is bound to as well as getting the various states of that node nsixformsdelegate - used to obtain the nsixformsaccessors interface nsixformsuiwidget - used by the xforms processor to update the value/state of an xforms element when its bound node's value/state is changed our current mechanism that allows authors to build custom controls assumes that the controls will be bound to instance nodes of simple content type.
XForms Repeat Element - Archive of obsolete content
to accommodate this, xforms 1.0 defines an alternative syntax that is functionally equivalent to the repeat element, using the following attributes: repeat-model repeat-bind repeat-nodeset repeat-startindex repeat-number additionally, when using xforms action setindex, its repeat attribute (which contains an idref) can point to any element carrying these repeat attributes.
XForms Secret Element - Archive of obsolete content
characteristics analogous widgets are <xhtml:input type="password"/> and <xul:textbox type="password"/> if the incremental attribute is present and has the value true, then the bound instance node is updated on every user input.
XForms Textarea Element - Archive of obsolete content
characteristics analogous widgets are <xhtml:textarea/> and <xul:textbox multiline="true"/> if the incremental attribute has the value true, then the bound instance node is updated on every user input.
XForms - Archive of obsolete content
this extension, while supporting a significant subset of the xforms 1.0 and 1.1 candidate recommendations, is not actively maintained any more since about 2010.
Window: devicelight event - Archive of obsolete content
candidate recommendation removed from specification ...
Archived open Web documentation - Archive of obsolete content
liveconnect (please update or remove as needed.) msx emulator (jsmsx) old proxy api proxies are objects for which the programmer has to define the semantics in javascript.
Choosing Standards Compliance Over Proprietary Practices - Archive of obsolete content
original document information author(s): beth epperson last updated date: 7 november 2014 ...
Correctly Using Titles With External Stylesheets - Archive of obsolete content
meyer last updated date: december 30th, 2002 copyright © 2001-2003 netscape.
Describing microformats in JavaScript - Archive of obsolete content
possible values are: datetime an iso date anyuri a uri email an email address tel a telephone number html html including tags float a floating-point number microformat a microformat microformat_property a specific property within the microformat specified by microformat.
Issues Arising From Arbitrary-Element hover - Archive of obsolete content
meyer, netscape communications last updated date: published 07 mar 2003; revised 21 mar 2003 copyright information: copyright © 2001-2003 netscape.
Mozilla's DOCTYPE sniffing - Archive of obsolete content
(this is technically incorrect, since the strings are case sensitive.) see also web development mozilla's quirks mode mozilla quirks mode behavior original document information author(s): david baron last updated date: august 2, 2005 copyright information: copyright (c) david baron ...
Popup Window Controls - Archive of obsolete content
original document information author(s): bob clary last updated date: december 5th, 2002 copyright © 2001-2003 netscape.
RDF in Fifty Words or Less - Archive of obsolete content
contact: chris waterson (waterson@netscape.com) original document information author(s): chris waterson last updated date: november 19, 1998 copyright information: copyright (c) chris waterson interwiki language link ...
Styling Abbreviations and Acronyms - Archive of obsolete content
meyer, netscape communications last updated date: published 09 aug 2002 copyright information: copyright © 2001-2003 netscape.
Using the Right Markup to Invoke Plugins - Archive of obsolete content
ranganathan, netscape communications last updated date: 14.
Index - Game development
4 index meta found 74 pages: 5 introduction to html5 game development (summary) firefox os, games, html5, mobile games built with html5 work on smartphones, tablets, pcs and smart tvs.update your game whenever you want.players can play the game anywhere, anytime.
Introduction to game development for the Web - Game development
again with more control, you can update your game whenever you want.
Building up a basic demo with A-Frame - Game development
add this code at the end of the <script> tag: var t = 0; function render() { t += 0.01; requestanimationframe(render); cylinder.setattribute('position', '3 '+(math.sin(t*2)+1)+' 0'); } render(); we're using the render() function to update the cylinder's position on every frame.
Building up a basic demo with Babylon.js - Game development
to show actual animation, we need to make changes to these values inside the rendering loop at the end of our code, so they are updated on every frame.
Building up a basic demo with Three.js - Game development
to show animation, we need to make changes to these values inside the render loop, so they update on each frame.
WebVR — Virtual Reality for the Web - Game development
for example: function setcustomfov(up,right,down,left) { var testfov = new vrfieldofview(up,right,down,left); ghmd.setfieldofview(testfov,testfov,0.01,10000.0); } the gpositionsensor variable holds the positionsensorvrdevice — using this you can get the current position or orientation state (for example to update the scene view on every frame), or reset the sensor.
Mobile touch controls - Game development
the stick being pressed can be handled during the gameplay in the update function like so: if(this.stick.isdown) { // move the player } we can adjust the player's velocity based on the current angle of the stick and move him appropriately.
Unconventional controls - Game development
when those variables are up-to-date, we can use them in the draw() function to move the ship: function draw() { ctx.clearrect(0, 0, canvas.width, canvas.height); // ...
Game over - Game development
update the last bit of code you modified again, to the following: if(y + dy < ballradius) { dy = -dy; } else if(y + dy > canvas.height-ballradius) { if(x > paddlex && x < paddlex + paddlewidth) { dy = -dy; } else { alert("game over"); document.location.reload(); clearinterval(interval); } } if the ball hits the bottom edge of the canvas we need to ch...
Mouse controls - Game development
add the following line in the same place as the other event listeners, just below the keyup event: document.addeventlistener("mousemove", mousemovehandler, false); anchoring the paddle movement to the mouse movement we can update the paddle position based on the pointer coordinates — the following handler function will do exactly that.
Build the brick field - Game development
update the brickx and bricky lines as follows: var brickx = (c*(brickinfo.width+brickinfo.padding))+brickinfo.offset.left; var bricky = (r*(brickinfo.height+brickinfo.padding))+brickinfo.offset.top; each brickx position is worked out as brickinfo.width plus brickinfo.padding, multiplied by the column number, c, plus the brickinfo.offset.left; the logic for the bricky is identical except that it uses ...
Buttons - Game development
to do that, adjust the update() function like so: function update() { game.physics.arcade.collide(ball, paddle, ballhitpaddle); game.physics.arcade.collide(ball, bricks, ballhitbrick); if(playing) { paddle.x = game.input.x || game.world.width*0.5; } } that way the paddle is immovable after everything is loaded and prepared, but before the start of the actual game.
Collision detection - Game development
first, add a new line inside your update() function that checks for collision detection between ball and bricks, as shown below: function update() { game.physics.arcade.collide(ball, paddle); game.physics.arcade.collide(ball, bricks, ballhitbrick); paddle.x = game.input.x || game.world.width*0.5; } the ball's position is calculated against the positions of all the bricks in the group.
Extra lives - Game development
to make it easier for us to maintain in the future we can create a separate variable that will hold our styling, let's call it textstyle and place it before the text definitions: textstyle = { font: '18px arial', fill: '#0095dd' }; we can now use this variable when stlying our text labels — update your code so that the multiple instances of the text styling are replaced with the variable: scoretext = game.add.text(5, 5, 'points: 0', textstyle); livestext = game.add.text(game.world.width-5, 5, 'lives: '+lives, textstyle); livestext.anchor.set(1,0); lifelosttext = game.add.text(game.world.width*0.5, game.world.height*0.5, 'life lost, click to continue', textstyle); lifelosttext.anchor.set(0...
Scaling - Game development
update your existing preload() function as follows: function preload() { game.scale.scalemode = phaser.scalemanager.show_all; game.scale.pagealignhorizontally = true; game.scale.pagealignvertically = true; } scalemode has a few different options available for how the canvas can be scaled: no_scale — nothing is scaled.
Ajax - MDN Web Docs Glossary: Definitions of Web-related terms
ajax allows you to update parts of the dom of an html page instead without the need for a full page refresh.
CRUD - MDN Web Docs Glossary: Definitions of Web-related terms
crud (create, read, update, delete) is an acronym for ways one can operate on stored data.
Canvas - MDN Web Docs Glossary: Definitions of Web-related terms
it is a low level, procedural model that updates a bitmap and does not have a built-in scene graph.
Delta - MDN Web Docs Glossary: Definitions of Web-related terms
likewise, given the new value of x and its old value, you might compute the delta like this: let deltax = newx - oldx; more commonly, you receive the delta and use it to update a saved previous condition: let newx = oldx + deltax; learn more technical reference mouse wheel events (wheelevent offer the amount the wheel moved since the last event in its deltax, deltay, and deltaz properties, for example.
Forbidden header name - MDN Web Docs Glossary: Definitions of Web-related terms
forbidden header names start with proxy- or sec-, or are one of the following names: accept-charset accept-encoding access-control-request-headers access-control-request-method connection content-length cookie cookie2 date dnt expect feature-policy host keep-alive origin proxy- sec- referer te trailer transfer-encoding upgrade via note: the user-agent header is no longer forbidden, as per spec — see forbidden header name list (this was implemented in firefox 43) — it can now be set in a fetch headers object, or via xhr setrequestheader().
General header - MDN Web Docs Glossary: Definitions of Web-related terms
the most common general headers are date, cache-control or connection.
Google Chrome - MDN Web Docs Glossary: Definitions of Web-related terms
google pushes updates frequently and has designed the distributions to run side-by-side with the stable version.
HTTP header - MDN Web Docs Glossary: Definitions of Web-related terms
a basic request with one header: get /example.http http/1.1 host: example.com redirects have mandatory headers (location): 302 found location: /newpage.html a typical set of headers: 304 not modified access-control-allow-origin: * age: 2318192 cache-control: public, max-age=315360000 connection: keep-alive date: mon, 18 jul 2016 16:06:00 gmt server: apache vary: accept-encoding via: 1.1 3dc30c7222755f86e824b93feb8b5b8c.cloudfront.net (cloudfront) x-amz-cf-id: tol0fem6ui4fgldrkjx0vao5hpkkgzulyn2twd2gawltr7vlnjtvzw== x-backend-server: developer6.webapp.scl3.mozilla.com x-cache: hit from cloudfront x-cache-info: cached ...
Houdini - MDN Web Docs Glossary: Definitions of Web-related terms
browsers create the cssom — including layout, paint, and composite processes — before applying any style updates found in scripts: layout, paint, and composite processes are repeated for updated javascript styles to be implemented.
I18N - MDN Web Docs Glossary: Definitions of Web-related terms
(the w3c definition) among other things, i18n requires support for multiple character sets (usually via unicode) units of measure (currency, °c/°f, km/miles, etc.) time and date formats keyboard layouts text directions learn more general knowledge i18n on wikipedia technical reference i18n on w3c i18n on gala-global.org learn about it i18n material on i18nguy.com ...
ICE - MDN Web Docs Glossary: Definitions of Web-related terms
ection, via the http port direct tcp connection, via the https port indirect connection via a relay/turn server (if a direct connection fails, e.g., if one peer is behind a firewall that blocks nat traversal) learn more general knowledge webrtc, the principal web-related protocol which uses ice webrtc protocols technical reference rfc 5245, the ietf specification for ice rtcicecandidate, the interface representing a ice candidate ...
Internationalization - MDN Web Docs Glossary: Definitions of Web-related terms
internationalization includes support for multiple character sets (usually via unicode), units of measure (currency, °c/°f, km/miles, etc.), date and time formats, keyboard layouts, and layout and text directions.
Layout viewport - MDN Web Docs Glossary: Definitions of Web-related terms
instead, the visual viewport is updated to indicate the area of the page that they can see.
Locale - MDN Web Docs Glossary: Definitions of Web-related terms
among other things, locales represent paper format, currency, date format, and numbers according to the protocols in the given region.
Localization - MDN Web Docs Glossary: Definitions of Web-related terms
10,000.00 in the u.s.) date format currency cultural references paper size color psychology compliance with local laws local holidays personal names learn more general knowledge localization at mozilla on mdn localization on wikipedia ...
Reflow - MDN Web Docs Glossary: Definitions of Web-related terms
reflow happens when a browser must process and draw part or all of a webpage again, such as after an update on an interactive site.
Response header - MDN Web Docs Glossary: Definitions of Web-related terms
note that strictly speaking, the content-encoding and content-type headers are entity header: 200 ok access-control-allow-origin: * connection: keep-alive content-encoding: gzip content-type: text/html; charset=utf-8 date: mon, 18 jul 2016 16:06:00 gmt etag: "c561c68d0ba92bbeb8b0f612a9199f722e3a621a" keep-alive: timeout=5, max=997 last-modified: mon, 18 jul 2016 02:36:04 gmt server: apache set-cookie: mykey=myvalue; expires=mon, 17-jul-2017 16:06:00 gmt; max-age=31449600; path=/; secure transfer-encoding: chunked vary: cookie, accept-encoding x-backend-server: developer2.webapp.scl3.mozilla.com x-cache-info: not c...
SPA (Single-page application) - MDN Web Docs Glossary: Definitions of Web-related terms
an spa (single-page application) is a web app implemention that loads only a single web document, and then updates the body content of that single document via javascript apis such as xmlhttprequest and fetch when different content is to be shown.
SQL Injection - MDN Web Docs Glossary: Definitions of Web-related terms
sql injection takes advantage of web apps that fail to validate user input.
TURN - MDN Web Docs Glossary: Definitions of Web-related terms
learn more general knowledge turn on wikipedia webrtc protocols technical reference specification specification update for ipv6 ...
Truthy - MDN Web Docs Glossary: Definitions of Web-related terms
examples of truthy values in javascript (which will be coerced to true in boolean contexts, and thus execute the if block): if (true) if ({}) if ([]) if (42) if ("0") if ("false") if (new date()) if (-42) if (12n) if (3.14) if (-3.14) if (infinity) if (-infinity) specifications specification ecmascript (ecma-262)the definition of 'toboolean abstract operation' in that specification.
W3C - MDN Web Docs Glossary: Definitions of Web-related terms
each standard passes through four stages of maturity: working draft (wd), candidate recommendation (cr), proposed recommendation (pr), and w3c recommendation (rec).
WebSockets - MDN Web Docs Glossary: Definitions of Web-related terms
through websocket, servers can pass data to a client without prior client request, allowing for dynamic content updates.
XInclude - MDN Web Docs Glossary: Definitions of Web-related terms
request2.open('get', href, false); request2.setrequestheader('if-modified-since', 'thu, 1 jan 1970 00:00:00 gmt'); request2.setrequestheader('cache-control', 'no-cache'); request2.send(null); response = request2[responsetype]; // update the response for processing } // replace xinclude with the response as text var textnode = docu.createtextnode(response); xincludeparent.replacechild(textnode, xinclude); } // replace xinclude in doc with response now (as plain text ...
caret - MDN Web Docs Glossary: Definitions of Web-related terms
<input type="text"> <input type="password"> <input type="search"> <input type="date">, <input type="time">, <input type="datetime">, and <input type="datetime-local"> <input type="number">, <input type="range"> <input type="email">, <input type="tel">, and <input type="url"> <textarea> any element with its contenteditable attribute set ...
Test your skills: CSS and JavaScript accessibility - Learn web development
update the css with these new values to fix the problem.
Test your skills: HTML accessibility - Learn web development
we want you to update it use appropriate semantic html.
Test your skills: WAI-ARIA - Learn web development
can you update it so that description changes are annouced by the screenreader?
Accessibility - Learn web development
wai-aria basics following on from the previous article, sometimes making complex ui controls that involve unsemantic html and dynamic javascript-updated content can be difficult.
Images, media, and form elements - Learn web development
many form controls are added to your page by way of the <input> element — this defines simple form fields such as text inputs, through to more complex fields added in html5 such as color and date pickers.
Overflowing content - Learn web development
you can also scroll on the x axis using overflow-x, although this is not a recommended way to accommodate long words!
Pseudo-classes and pseudo-elements - Learn web development
it acts as if a <span> was magically wrapped around that first formatted line, and updated each time the line length changed.
Flexbox - Learn web development
however you should be aware that there are still older browsers in use that don't support flexbox (or do, but support a really old, out-of-date version of it.) while you are just learning and experimenting, this doesn't matter too much; however if you are considering using flexbox in a real website you need to do testing and make sure that your user experience is still acceptable in as many browsers as possible.
Test your skills: floats - Learn web development
use the most up to date method available to cause the box background to extend to below the float as in the image.
Supporting older browsers - Learn web development
this also means that there are some outdated articles and tutorials in existence; this useful guide helps you check what you are looking at and can also help if you need flex support in very old browsers.
Test your skills: Media Queries and Responsive Design - Learn web development
your task is to create a desktop version of this layout which displays when there is enough screen width to accomodate it.
How CSS works - Learn web development
the updated output is as follows: in our debugging css article in the next module we will be using browser devtools to debug css problems, and will learn more about how the browser interprets css.
Styling links - Learn web development
we want to fill up the whole width of the <ul>, leave a little margin between each button (but not a gap at the right hand edge), and we have 5 buttons to accommodate that should all be the same size.
Web fonts - Learn web development
inside the unzipped directory you'll see three useful items: multiple versions of each font: (for example .ttf, .woff, .woff2, etc.; the exact fonts provided will be updated over time as browser support requirements change).
How do you make sure your website works properly? - Learn web development
you won't see this much in your browser, but it's good to know about "301" since search engines use this information a lot to update their indexes.
How do you host your website on Google App Engine? - Learn web development
if you've not created a project before, you'll need to select whether you want to receive email updates or not, agree to the terms of service, and then you should be able to continue.
How much does it cost to do something on the Web? - Learn web development
will you want to update it regularly?
What is a web server? - Learn web development
we call it "dynamic" because the application server updates the hosted files before sending content to your browser via the http server.
What is accessibility? - Learn web development
also, make sure people can adjust the volume to accommodate their unique needs.
Basic native form controls - Learn web development
it is used for creating most types of form widgets including single line text fields, time and date controls, controls without text input like checkboxes, radio buttons, and color pickers, and buttons.
Example - Learn web development
<option value="visa">visa</option> <option value="mc">mastercard</option> <option value="amex">american express</option> </select> </p> <p> <label for="number"> <span>card number:</span> <strong><abbr title="required">*</abbr></strong> </label> <input type="tel" id="number" name="cardnumber"> </p> <p> <label for="date"> <span>expiration date:</span> <strong><abbr title="required">*</abbr></strong> <em>formatted as mm/dd/yyyy</em> </label> <input type="date" id="date" name="expiration"> </p> </section> <section> <p> <button type="submit">validate the payment</button> </p> </section> </form> css content h1 { margin-top: 0; } ul { margin: 0; padding...
CSS property compatibility table for form controls - Learn web development
date pickers see the date and time input types.
Sending form data - Learn web development
previous overview: forms once the form data has been validated on the client-side, it is okay to submit the form.
Sending forms through JavaScript - Learn web development
note: the fetch api is often used in place of xhr these days — it is a modern, updated version of xhr, which works in a similar fashion but has some advantages.
UI pseudo-classes - Learn web development
note: numeric input types are date, month, week, time, datetime-local, number, and range.
HTML Cheatsheet - Learn web development
a line break line 1<br>line 2 line 1 line 2 suggesting a line break it is used to suggest the browser to cut the text on this site if </wbr>there is not enough space to display it on the same line it is used to suggest the browser to cut the text on this site if there is not enough space to display it on the same line date in readable form it is used to format the date legibly for the user, such as: <time datetime="2020-05-24" pubdate>published on 23-05-2020</time> it is used to format the date legibly for the user, such as: published on 23-05-2020 text displayed in code format <p>this text is in normal format.</p> <code>this text is in code format.</code> <pre>this text is in prede...
Tips for authoring fast-loading HTML pages - Learn web development
.html, .css), based on the last-modified date stored in the file system.
Use JavaScript within a webpage - Learn web development
that means, don't update content, redirect, or refresh automatically.
Use HTML to solve common problems - Learn web development
LearnHTMLHowto
how to add multiple languages into a single webpage how to display time and date with html performance how to author fast-loading html pages ...
Video and audio content - Learn web development
take a look at the following updated example (try it live here, also): <video controls> <source src="rabbit320.mp4" type="video/mp4"> <source src="rabbit320.webm" type="video/webm"> <p>your browser doesn't support html5 video.
HTML table basics - Learn web development
LearnHTMLTablesBasics
update the contents of your table to look like so: <td>hi, i'm your first cell.</td> <td>i'm your second cell.</td> <td>i'm your third cell.</td> <td>i'm your fourth cell.</td> as you will see, the cells are not placed underneath each other, rather they are automatically aligned with each other on the same row.
How to contribute to the Learning Area on MDN - Learn web development
it may see periodical improvements or updates, and may eventually even be cleaned up (and de-archived) for better uxp focus, but for now, it's a historical snapshot for reference, not a living website.
Making asynchronous programming easier with async and await - Learn web development
} each one ends by recording a start time, seeing how long the timetest() promise takes to fulfill, then recording an end time and reporting how long the operation took in total: let starttime = date.now(); timetest().then(() => { let finishtime = date.now(); let timetaken = finishtime - starttime; alert("time taken in milliseconds: " + timetaken); }) it is the timetest() function that differs in each case.
Introduction to events - Learn web development
of the three mechanisms, you shouldn't use the html event handler attributes — these are outdated, and bad practice, as mentioned above.
Function return values - Learn web development
it is generally a good idea to check that any necessary parameters are validated, and that any optional parameters have some kind of default value provided.
Manipulating documents - Learn web development
you can set properties of this object to directly update element styles.
Client-side web APIs - Learn web development
fetching data from the server another very common task in modern websites and applications is retrieving individual data items from the server to update sections of a webpage without having to load an entirely new page.
Handling text — strings in JavaScript - Learn web development
try the following (we are using the typeof operator to check whether the variable is a number or a string): let mydate = '19' + '67'; typeof mydate; if you have a numeric variable that you want to convert to a string but not change otherwise, or a string variable that you want to convert to a number but not change otherwise, you can use the following two constructs: the number object converts anything passed to it into a number, if it can.
Test your skills: Strings - Learn web development
we want you to fix and update it, like so: change the casing to correct sentence case (all lowercase, except for upper case first letter).
Storing the information you need — Variables - Learn web development
updating a variable once a variable has been initialized with a value, you can change (or update) that value by simply giving it a different value.
Solve common problems in your JavaScript code - Learn web development
how do you update a variable's value?
Inheritance in JavaScript - Learn web development
an updated greeting() method, which sounds a bit more formal than the standard greeting() method — more suitable for a teacher addressing some students at school.
JavaScript — Dynamic client-side scripting - Learn web development
every time a web page does more than just sit there and display static information for you to look at—displaying timely content updates, interactive maps, animated 2d/3d graphics, scrolling video jukeboxes, or more—you can bet that javascript is probably involved.
Measuring performance - Learn web development
tools that update code so that your web app or site will perform better.
Perceived performance - Learn web development
first paint is reported by the browser and provides the time, in ms, of when the page starts changing; but this change can be a simple background color update or something even less noticable.
Learning area release notes - Learn web development
march 2020 you'll now find "test your skills" assessments accompanying the articles in the following modules: css building blocks javascript first steps javascript building blocks introducing javascript objects january 2020 the html forms module has been significantly updated: it has been retitled web forms, and moved out of the html topic area to recognise that it covers more than just html form elements — it also covers styling, validation, the basics of how to send data and process it on the server, and more besides.
Server-side website programming - Learn web development
displaying all of these using different static pages would be extremely inefficient, so instead such sites display static templates (built using html, css, and javascript), and then dynamically update the data displayed inside those templates when needed, such as when you want to view a different product on amazon.
Getting started with Ember - Learn web development
ember also has immense backwards and forwards compatibility to help businesses stay up to date with the latest versions of ember and latest community-driven conventions.
React resources - Learn web development
routing while routing is traditionally handled by a server and not an application on the user's computer, it is possible to configure a web application to read and update the browser's location, and render certain user interfaces.
Getting started with Vue - Learn web development
it is recommended that you specify a version number when including vue on your site so that any framework updates do not break your live site without you knowing.) <script src="/static/external/29/29296ccacaa9ed35ed168fc51e36f54fd6f8db9c7786bbf38cc59a27229ba5c2.svg"></script> however, this approach has some limitations.
Rendering a list of Vue components - Learn web development
update the label="my todo item" attribute to :label="item.label", and the :done="false" attribute to :done="item.done", as seen in context below: <ul> <li v-for="item in todoitems" :key="item.id"> <to-do-item :label="item.label" :done="item.done"></to-do-item> </li> </ul> now when you look at your running app, it'll show the todo items with their proper names, and if you inspect the sour...
Introduction to cross browser testing - Learn web development
there are commercial tools available such as sauce labs, browser stack, endtest, lambdatest, testingbot, and crossbrowsertesting that do this kind of thing for you, without you having to worry about the setup, if you wish to invest some money in your testing.
Understanding client-side web development tools - Learn web development
package management basics in this article we'll look at package managers in some detail to understand how we can use them in our own projects — to install project tool dependencies, keep them up-to-date, and more.
Accessibility information for UI designers and developers
this is specifically important in these cases: the user input is about legal commitments or financial transactions it updates or removes the user's data in a system when recording tests responses in those cases, ensure users can change submissions, automatically check for errors.
Gecko info for Windows accessibility vendors
keeping an internal cache current means getting new subtrees of iaccessibles whenever an event_reorder is received, indicating important changes have invalidated part of the model.
Information for users
assistive technology compatibility this is a wiki page which users can edit to provide up to date information on any issues related to compatibility with assistive technologies such as screen readers, screen magnifiers, voice input software and on screen keyboards.
Accessibility and Mozilla
all accessibility apis to date define a list of possible object roles, or general types, such as button, menu item, text, etc.
Obsolete
this page contains theme documents and resources that we don't expect will ever be updated, but which we're keeping for the time being as potential source material for updated docs.
Adding a new word to the en-US dictionary
build firefox and test your updated dictionary.
Chrome registration
to update your add-on to work without this flag: if your add-on depends upon xbl bindings attached to content objects (that is, it needs to be able to call functions or get and set properties created by the xbl binding), you'll need to use the object's wrappedjsobject property to obtain a wrapped object.
Cookies Preferences in Mozilla
(the old prefs are network.cookie.lifetime.enabled, network.cookie.lifetime.behavior, and network.cookie.warnaboutcookies.) true = prefs have been migrated false = migrate prefs on next startup original document information author(s): mike connor last updated date: may 22, 2004 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Cookies in Mozilla
original document information author(s): mike connor last updated date: march 15, 2004 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Creating Sandboxed HTTP Connections
since the channel that causes the notification is passed in as the first argument, comparing it to the globally stored channel (gchannel) in the previous section (which also gets updated each time a redirect happens).
Debugging Frame Reflow
original document information author(s): bernd mielke last updated date: december 4, 2004 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Debugging JavaScript
ines = []; for (var frame = components.stack; frame; frame = frame.caller) { lines.push(frame.filename + " (" + frame.linenumber + ")"); } return lines.join("\n"); } see also debugging mozilla with gdb setting up an extension development environment (particularly development preferences and development extensions) original document information author(s): ben bucksch created date: september 12, 2005, last updated date: november 10, 2009 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Debugging Table Reflow
debug_table_reflow_timing needs to be written original document information author(s): bernd mielke other contributors: bernd mielke, josh soref last updated date: november 20, 2005 ...
Debugging a hang on OS X (Archived)
warning: the content of this article may be out of date.
Debugging on Windows
type/copy/drag the memory address of "int 3" into the memory view to get it to update on that part of the memory.
Debugging
debugging update problems learn how to debug update problems in mozilla-based applications.
Configuring Build Options
this saves a considerable amount of time directly after a clobber build, so pulling in new updates and rebasing is less time-consuming.
Makefiles - Best practices and suggestions
for ex, individual unit tests would invalidate all prior test activity whenever a test touched a timestamp file in the directory to signal success.
Simple Firefox for Android build
deprecated: this documentation has moved, please visit geckoview-quick-start for up-to-date documentation on building geckoview for android.
Simple SeaMonkey build
this will accomodate visual studio 2013 community edition, the required sdks, the mozillabuild package, the mercurial source repository and enough free disk space to compile.
Simple Thunderbird build
to run the executable from your comm-central working directory: windows: obj-.../dist/bin/thunderbird.exe linux: obj-.../dist/bin/thunderbird macos: obj-.../dist/daily.app/contents/macos/thunderbird how to update and build again in your source directory: hg pull -u cd comm hg pull -u cd ..
Contributing to the Mozilla code base
they too are good candidates.
SVG Guidelines
to this date, there doesn't seem to be a tool that handles all of the above.
mach
in other words, mach is not a power play to consolidate authority for tooling.
Developer guide
getting documentation updated how to ensure that documentation is kept up to date as you develop.
Experimental features in Firefox
nightly 53 yes developer edition 53 no beta 53 no release 53 no preference name dom.dialog_element.enabled global attribute: inputmode our implementation of the inputmode global attribute has been updated as per the whatwg spec (bug 1509527), but we still need to make other changes too, like making it available on contenteditable content.
Limitations of chrome scripts
for each pattern we've noted: whether a shim exists and what kind of behavior it provides how to update your add-on so you don't need the shim gbrowser.contentwindow, window.content...
Communicating with frame scripts
// on some event var browsermm = gbrowser.selectedbrowser.messagemanager; browsermm.loadframescript("chrome://my-addon@me.org/content/frame-script.js", false); messagemanagers.push(browsermm); console.log(messagemanagers.length); we can listen for message-manager-disconnect to update the array when the message managers disconnect (for example because the user closed the tab): function myobserver() { } myobserver.prototype = { observe: function(subject, topic, data) { var index = messagemanagers.indexof(subject); if (index != -1) { console.log("one of our message managers disconnected"); mms.splice(index, 1); } }, register: function() { var ...
Multiprocess Firefox
limitations of chrome scripts practices that will no longer work in chrome code, and how to update them.
Storage access policy: Block cookies from trackers
we’ll keep this page updated with the newest information as we strengthen our protections.
Security best practices for Firefox front-end engineers
appendix list of disallowed dom apis innerhtml outerhtml insertadjacenthtml() createcontextualfragment() document.write() document.writeln() please take a look at the repository for an updated list ...
Firefox and the "about" protocol
menu > options) about:privatebrowsing start page when opening a private window about:profiles display and manage firefox profiles about:protections privacy protections report consisting of enhanced tracking protection, firefox monitor and firefox lockwise data about:restartrequired a page users are sent to when firefox requires a restart due to an update about:reader indicates a web page has firefox reader view turned on.
mozbrowsercaretstatechanged
possible values are visibilitychange, updateposition, longpressonemptycontent, taponcaret, presscaret, and releasecaret.
mozbrowserloadend
this can be used when the embedder wants to stop spinning a loading indicator, or update the ui in some other way to indicate loading is complete.
mozbrowserloadstart
this can be used when the embedder wants to start spinning a loading indicator, or update the ui in some other way to indicate loading has started.
mozbrowserlocationchange
example this example updates the url bar so that it will always display the correct url for the current location.
HTMLIFrameElement.reload()
parameters hardreload optional a boolean that indicates whether all the resources to reload must be revalidated (true) or may be taken directly from the browser cache (false).
Overview of Mozilla embedding APIs
interface definition: defining new xpcom components original document information author(s): rpotts, alecf, oeschger at netscape.com last updated date: march 5, 2003 copyright information: creative commons ...
Gecko SDK
get the sdk updates there is no need to download or rebuild the gecko sdk corresponding to security updates of mozilla (e.g., mozilla 1.7.3) since the headers and glue libs in the gecko sdk are usually not changed as a result of security updates.
Gecko
roadmaps and more up-to-date resources.
Getting Started with Chat
please see https://wiki.mozilla.org/matrix for up-to-date information.
How Mozilla determines MIME Types
related information document loading - from load start to finding a handler original document information author(s): christian biesinger last updated date: march 7, 2005 copyright information: copyright (c) christian biesinger ...
How to get a stacktrace with WinDbg
(again, press enter after each command.) ~* kp !analyze -v -f lm after these steps are completed, find the file c:\temp\firefox-debug-(today's date).txt on your hard drive.
IPDL Tutorial
see ipc/ipdl/ipdl/builtin.py for the most up-to-date list of automatically imported types.
Implementing QueryInterface
original document information author(s): scott collins last updated date: may 8, 2003 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Integrated Authentication
original document information author(s): darin fisher last updated date: december 27, 2005 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Internationalized Domain Names (IDN) Support in Mozilla Browsers
original document information author(s): katsuhiko momoi last updated date: 03 jul 2003 learn moreedit general knowledge emoji keyboard online ...
JavaScript-DOM Prototypes in Mozilla
original document information author(s): fabian guisset last updated date: february 2, 2002 copyright information: copyright (c) fabian guisset ...
AddonInstall
existingaddon addon the addon that this install will update.
AddonListener
only applies to the following properties: applybackgroundupdates void onpropertychanged( in addon addon, in string properties[] ) parameters addon the addon that has had its properties changed properties an array of the names of properties that changed.
DownloadList
the returned array does not change when downloads are added or removed, though the download objects it contains are still updated in real time.
OSFile.jsm
shared components os.path and os.constants.path manipulation of paths os.file.error representation of file-related errors os.file.info representation of file information (size, creation date, etc.) os.file.directoryiterator.entry file information obtained while visiting a directory ...
Deferred
function deferred() { // update 062115 for typeof if (typeof(promise) != 'undefined' && promise.defer) { //need import of promise.jsm for example: cu.import('resource:/gree/modules/promise.jsm'); return promise.defer(); } else if (typeof(promiseutils) != 'undefined' && promiseutils.defer) { //need import of promiseutils.jsm for example: cu.import('resource:/gree/modules/promiseutils.jsm'); return promiseutils.defer()...
Sqlite.jsm
for insert, update, and delete statements, this is not relevant.
openLocationLastURL.jsm
if the user is not in private browsing mode, this automatically updates the value of the general.open_location.last_url preference.
source-editor.jsm
setselection(number astart, number aend); breakpoint management void addbreakpoint(number alineindex, [optional] string acondition); array getbreakpoints(); boolean removebreakpoint(number alineindex); properties attribute type description dirty boolean set this value to false whenever you save the text; the editor will update it to true when the content is changed.
JavaScript code modules
iso8601dateutils.jsm provides routines to convert between javascript date objects and iso 8601 date strings.
Application Translation with Mercurial
extract the files: hg update obtaining the texts of your localization go back to the parent folder of mozilla-aurora: cd ..
Localization and Plurals
install pluralform checker v0.3 extension extension input it would be good to keep this list updated with all the words that need plural forms.
Localization sign-off reviews
the merge date for migrating from one product release channel to the next is rapidly approaching.
Web Localizability
the content will be easier to maintain and update.
gettext
# #, fuzzy msgid "" msgstr "" "project-id-version: package version\n" "report-msgid-bugs-to: \n" "pot-creation-date: 2009-09-28 16:18+0200\n" "po-revision-date: year-mo-da ho:mi+zone\n" "last-translator: full name <email@address>\n" "language-team: language <ll@li.org>\n" "mime-version: 1.0\n" "content-type: text/plain; charset=charset\n" "content-transfer-encoding: 8bit\n" "plural-forms: nplurals=integer; plural=expression;\n" #.
MathML3Testsuite
ynames numericrefs utf8 general clipboard genattribs math presentation css dynamicexpressions generallayout scriptsandlimits tablesandmatrices tokenelements topics accents bidi elementarymathexamples embellishedop largeop linebreak nesting stretchychars whitespace torturetests errorhandling original document information author(s): frédéric wang other contributors: last updated date: may 26, 2010 copyright information: portions of this content are © 2010 by individual mozilla.org contributors; content available under a creative commons license | details.
Using the viewport meta tag to control layout on mobile browsers
as the standardization process proceeds, we at mozilla will work to keep up to date with any changes.
Mozilla Development Tools
original document information author(s): myk melez last updated date: november 8, 2005 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
BloatView
byte bloats name file date blank blank.txt tue aug 29 14:17:40 2000 mozilla mozilla.txt tue aug 29 14:18:42 2000 yahoo yahoo.txt tue aug 29 14:19:32 2000 netscape netscape.txt tue aug 29 14:20:14 2000 the numbers do not include malloc 'd data such as string contents.
Intel Power Gadget
(an energia dashboard can be seen here; please note that the data has not been updated since early 2014.) version 3.0 (available on mac and windows, but not on linux) also exposes an api from which the same measurements can be extracted programmatically.
JS::PerfMeasurement
the counter variables do not update in real time; they only change when stop is called.
Leak-hunting strategies and tips
this document is old and some of the information is out-of-date.
Power profiling overview
they are also updated frequently, at approximately 1,000 hz, though the variability in their update latency means that they are probably only accurate at lower frequencies, e.g.
Profiling with the Firefox Profiler
your profile will now, hopefully, be updated with symbols.
browser.altClickSave
type:boolean default value: false exists by default: yes application support:firefox 13.0 status: active; last updated 2012-03-19 introduction: pushed to nightly on 2012-03-02 bugs: bug 713052 values true clicking a link while holding the alt key starts the download of that link.
browser.dom.window.dump.file
type:string default value:none exists by default: no application support: gecko 1.9.2 (firefox 3.6 / thunderbird 3.1 / fennec 1.0) status: active; last updated 2012-03-18 introduction: pushed to nightly on 2009-04-24 bugs: bug 489938 values the value holds the file system path for the file in which the content of the window.dump() calls get written, e.g.
browser.download.lastDir.savePerSite
type:boolean default value:true exists by default: no application support:firefox 11.0 status: active; last updated 2012-02-15 introduction: pushed to nightly on 2011-12-11 bugs: bug 702748 values true (default) the last used directory for the website (host) serving the file for download will be preselected in the file picker.
browser.pagethumbnails.capturing_disabled
type:boolean default value:true exists by default: no application support: firefox 14.0 status: active; last updated 2012-09-17 introduction: pushed to nightly on 2012-04-13 bugs: bug 726347 values false the application creates screenshots of visited web pages.
browser.search.context.loadInBackground
type:boolean default value:false exists by default: yes application support: firefox 13.0 status: active; last updated 2012-02-17 introduction: pushed to nightly on 2012-02-15 bugs: bug 727131 values true new tab with search results will be opened in the background, focus stays on the current tab.
browser.urlbar.formatting.enabled
type:boolean default value: true exists by default: yes application support:firefox 6.0 status: active; last updated 2012-04-03 introduction: pushed to nightly on 2011-05-03 bugs: bug 451833 values true (default) the domain name including the top level domain is highlighted in the address bar by coloring it black and the other parts grey.
browser.urlbar.trimURLs
type:boolean default value: true exists by default: yes application support:firefox 7.0 status: active; last updated 2012-04-03 introduction: pushed to nightly on 2011-06-23 bugs: bug 665580 values true (default) if the active url is exactly the domain name, the trailing slash (/) behind the top level domain will be hidden.
dom.event.clipboardevents.enabled
type:boolean default value:true exists by default: no application support: gecko 13.0 (firefox 13.0 / thunderbird 13.0 / seamonkey 2.10) status: active; last updated 2012-02-15 introduction: pushed to nightly on 2012-02-14 bugs: bug 542938 values true (default) the oncopy, oncut and onpaste events are enabled for web content.
mail.tabs.drawInTitlebar
type:boolean default value: true exists by default: yes application support:thunderbird 17.0 status: active; last updated 2012-09-17 introduction: pushed to daily on 2012-08-08 bugs: bug 771816 values true (default) the tabs are drawn in the title bar of the mail program.
reader.parse-on-load.force-enabled
type:boolean default value: false exists by default: yes application support:firefox mobile 23.0 status: active; last updated 2013-05-11 introduction: pushed to nightly on 2013-05-06 bugs: bug 867875 values true reader mode is enabled independent of memory available.
ui.SpellCheckerUnderline
type:string default value:#ff0000 exists by default: no application support: gecko 1.9.2 (firefox 3.6 / thunderbird 3.1 / fennec 1.0) status: active; last updated 2012-02-21 introduction: pushed to nightly on 2009-04-03 bugs: bug 338209 values a color code like #ff0000 for red.
ui.SpellCheckerUnderlineStyle
type:integer default value:5 exists by default: no application support: gecko 1.9.2 (firefox 3.6 / thunderbird 3.1 / fennec 1.0) status: active; last updated 2012-02-22 introduction: pushed to nightly on 2009-04-03 bugs: bug 338209 values the values are defined in nsstyleconsts.h.
ui.alertNotificationOrigin
type:integer default value:dependent on position of taskbar or equivalent exists by default: no application support: gecko 1.8.1.2 (firefox 2.0.0.2 / thunderbird 2.0.0.4 / seamonkey 1.1) status: active; last updated 2012-02-22 introduction: pushed to nightly on 2007-01-04 bugs: bug 133527 values 0 bottom right corner, vertical slide-in from the bottom 1 bottom right corner, horizontal slide-in from the right 2 bottom left corner, vertical slide-in from the bottom 3 bottom left corner, horizontal slide-in from the left 4 top right corner, vertical slide-in from the top 5 top right corner, horizontal slide-in from the right 6...
ui.textSelectBackground
type:string with rgb hex value as color code default value:#ef0fff (blue) [1] exists by default: no application support: before gecko 1.7 status: active; last updated 2015-09-21 introduction: pushed to trunk on 2000-04-13 bugs: bug 34704 [1]: nsxplookandfeel.cpp, line 628, retrieved 2015-09-21 ...
ui.textSelectForeground
type:string with rgb hex value as color code default value:#ffffff (white) [1] exists by default: no application support: before gecko 1.7 status: active; last updated 2015-09-21 introduction: pushed to trunk on 2000-04-13 bugs: bug 34704 [1]: nsxplookandfeel.cpp, line 635, retrieved 2015-09-21 ...
ui.tooltipDelay
type:integer default value:500 exists by default: no application support: gecko 11.0 (firefox 11.0 / thunderbird 11.0 / seamonkey 2.8) status: active; last updated 2012-02-21 introduction: pushed to nightly on 2011-12-15 bugs: bug 204786 values integer (milliseconds, default: 500) the time for delay between the mouse stopping over the element and the tooltip appearing is stored in milliseconds and the default value is 500ms.
Research and prep
here's the basic process: file a bug under mozilla localizations>[your_locale] to request updates to your locale's productization preferences.
L20n HTML Bindings
<link rel="localization" href="../locales/manifest.json"> an example of the manifest file (all keys are required): { "locales": [ "en-us", "pl"], "default_locale": "en-us", "resources": [ "../locales/{{locale}}/strings.l20n", "/shared/{{locale}}/date.l20n"¨ ] } make html elements localizable use the data-l10n-id attribute on an html element to mark it as localizable.
Localization Use Cases
0 : 1; var sizeinfo = filesizeformatter.getreadablefilesize(size, fixeddigits); var _ = navigator.mozl10n.get; element.textcontent = _(l10nid, { size: sizeinfo.size, unit: _('byteunit-' + sizeinfo.unit) }); } the function is used like so: // application storage updateappfreespace: function storage_updateappfreespace() { var self = this; this.getfreespace(this.appstorage, function(freespace) { devicestoragehelper.showformatedsize(self.appstoragedesc, 'availablesize', freespace); }); }, problem definition for all values of freespace, the following string is enough to construct a grammatically-correct sentence in english: availablesize = {{$si...
L20n
note: this document is in draft form/out-of-date — for current documentation please see our documentation on github.
Leak And Bloat Tests
1txfw.minimum/mail/local folders"); user_pref("mail.server.server2.directory", "/home/moztest/.thunderbird/t7i1txfw.minimum/mail/tinderbox"); user_pref("mail.attachment.store.version", 1); user_pref("mail.folder.views.version", 1); user_pref("mail.spam.version", 1); user_pref("mailnews.quotingprefs.version", 1); user_pref("mailnews.ui.threadpane.version", 6); changes to leak and bloat tests date and time (pst) description approx effect on numbers pre dec 2008 initial version - 2008/12/07 11:20 bug 463594 disabled os x and outlook address books via the preference settings mac lk -56.2kb.
About NSPR
original document information author: larryh@netscape.com last updated date: 2000 (portions of the introduction moved to the history section in 2012) ...
Creating a Cookie Log
original document information author(s): mike connor last updated date: december 4, 2004 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
NSPR Poll Method
original document information author: wan teh chang last updated date: june 27, 2006 ...
NSPR's Position On Abrupt Thread Termination
freier last updated date: december 1998 ...
Nonblocking IO In NSPR
original document information author: wan-teh chang last updated date: october 30, 1997 ...
Process Forking in NSPR
freier last updated date: 1998 ...
Introduction to NSPR
each thread has a built-in per-thread error number and error string that are updated when nspr operations fail.
Named Shared Memory
these limits may be adjusted on some platforms either via boot-time options or by setting the size of the system paging space to accommodate more and/or larger shared memory segment(s).
PL_strdup
description to accommodate the terminator, the size of the allocated memory is one greater than the length of the string being copied.
PRTime
note: keep in mind that while prtime stores times in microseconds since epoch, javascript date objects store times in milliseconds since epoch.
PR GetCanonNameFromAddrInfo
this pointer is invalidated once the praddrinfo structure is destroyed by a call to pr_freeaddrinfo.
PR_NormalizeTime
for example, if you have a ] object that represents the date 3 march 1998 and you want to say "forty days from 3 march 1998", you can simply add 40 to the tm_mday field and then call pr_normalizetime().
PR_Open
pr_sync 0x40 if set, each write will wait for both the file data and file status to be physically updated.
PR_SetError
description nspr does not validate the value of the error number or os error number being specified.
PR_VERSION
syntax #include <prinit.h> #define pr_version "2.1 yyyymmdd" description the format of the version string ismajorversion.minorversion builddate.
NSPR API Reference
ons converting between host and network addresses memory-mapped i/o functions anonymous pipe function polling functions pollable events manipulating layers network addresses network address types and constants network address functions atomic operations pr_atomicincrement pr_atomicdecrement pr_atomicset interval timing interval time type and constants interval functions date and time types and constants time parameter callback functions functions memory management operations memory allocation functions memory allocation macros string operations pl_strlen pl_strcpy pl_strdup pl_strfree floating point number to string conversion pr_strtod pr_dtoa pr_cnvtf long long (64-bit) integers bitmaps formatted printing linked lists linked list t...
Building NSS
if you don't have a domain suffix you can add an entry to /etc/hosts (on windows, c:\windows\system32\drivers\etc\hosts) as follows: 127.0.0.1 localhost.localdomain validate this opening a command shell and typing: ping localhost.localdomain.
Getting Started With NSS
you are welcome to download the samples via: hg clone https://hg.mozilla.org/projects/nss; cd nss; hg update samples_branch how to contribute ...
4.3.1 Release Notes
release date: 2009-12-02 introduction network security services for java (jss) 4.3.1 is a minor release with the following new features: support for ssl3 & tls renegotiation vulnerablity support to explicitly set the key usage for the generated private key jss 4.3.1 is tri-licensed under mpl 1.1/gpl 2.0/lgpl 2.1.
4.3 Release Notes
release date: 01 april 2009 introduction network security services for java (jss) 4.3 is a minor release with the following new features: sqlite-based shareable certificate and key databases libpkix: an rfc 3280 compliant certificate path validation library pkcs11 needslogin method support hmacsha256, hmacsha384, and hmacsha512 support for all nss 3.12 initialization options jss 4.3 is tri-licensed under mpl 1.1/gpl 2.0/lgpl 2.1.
NSS_3.12.1_release_notes.html
ertforkey bug 428103: cert_encodesubjectkeyid is not defined in any public header file bug 429716: debug builds of libpkix unconditionally dump socket traffic to stdout bug 430368: vfychain -t option is undocumented bug 430369: vfychain -o succeeds even if -pp is not specified bug 430399: vfychain -pp crashes bug 430405: error log is not produced by cert_pkixverifycert bug 430743: update ssltap to understand the tls session ticket extension bug 430859: pkix: policy mapping fails verification with error invalid arguments bug 430875: document the policy for the order of cipher suites in ssl_implementedciphers.
NSS_3.12.2_release_notes.html
handle 0 bug 205434: fully implement new libpkix cert verification api from bug 294531 bug 302670: use the installed libz.so where available bug 305693: shlibsign generates pqg for every run bug 311483: exposing includecertchain as a parameter to sec_pkcs12addcertandkey bug 390527: get rid of pkixerrormsg variable in pkix_error bug 391560: libpkix does not consistently return pkix_validatenode tree that truly represent failure reasons bug 408260: certutil usage doesn't give enough information about trust arguments bug 412311: replace pr_interval_no_wait with pr_interval_no_timeout in client initialization calls bug 423839: add multiple pkcs#11 token password command line option to nss tools.
NSS 3.12.5 release_notes
see the following struct in nss.h for details: nssinitparametersstr other new functions in secmod.h: secmod_getskipfirstflag secmod_getdefaultmoddbflag in prlink.h nss_securememcmp port_loadlibraryfromorigin modified functions sgn_update (see cryptohi.h) the parameter "input" of this function is changed from unsigned char * to const unsigned char *.
NSS 3.12.6 release notes
bug 275744: support for tls compression rfc 3749 bug 494603: update nss's copy of sqlite3 to 3.6.22 to get numerous bug fixes bug 496993: add accessor functions for ssl_implementedciphers bug 515279: cert_pkixverifycert considers a certificate revoked if cert_processocspresponse fails for any reason bug 515870: gcc compiler warnings in nss 3.12.4 bug 518255: the input buffer for sgn_update should be declared const bug ...
NSS 3.14.3 release notes
however, this attack is only partially mitigated if nss 3.14.3 is used with the current fips validated nss cryptographic module, version 3.12.9.1.
NSS 3.15.4 release notes
updated the set of root ca certificates (version 1.96).
NSS 3.15.5 release notes
notable changes in nss 3.15.5 bug 950129: improve the ocsp fetching policy when verifying ocsp responses bug 949060: validate the iov input argument (an array of priovec structures) of ssl_writev (called via pr_writev).
NSS 3.16.4 release notes
it was removed in nss 3.16.3, but discussion in the mozilla.dev.security.policy forum led to the decision to keep this root included longer in order to give website administrators more time to update their web servers.
NSS 3.16 release notes
the built-in roots module has been updated to version 1.97, which adds, removes, and distrusts several certificates.
NSS 3.17.3 release notes
ty sha1 fingerprint: d1:cb:ca:5d:b2:d5:2a:7f:69:3b:67:4d:e5:f0:5a:1d:0c:95:7d:f0 cn = globalsign ecc root ca - r4 sha1 fingerprint: 69:69:56:2e:40:80:f4:24:a1:e7:19:9f:14:ba:f3:ee:58:ab:6a:bb cn = globalsign ecc root ca - r5 sha1 fingerprint: 1f:24:c6:30:cd:a4:18:ef:20:69:ff:ad:4f:dd:5f:46:3a:1b:69:aa the version number of the updated root ca list has been set to 2.2 bugs fixed in nss 3.17.3 this bugzilla query returns all the bugs fixed in nss 3.17.3: https://bugzilla.mozilla.org/buglist.cgi?resolution=fixed&classification=components&query_format=advanced&product=nss&target_milestone=3.17.3 compatibility nss 3.17.3 shared libraries are backward compatible with all older nss 3.x shared libraries.
NSS 3.17 release notes
new macros in ssl.h ssl_reuse_server_ecdhe_key notable changes in nss 3.17 the manual pages for the certutil and pp tools have been updated to document the new parameters that had been added in nss 3.16.2.
NSS 3.18 release notes
g2 sha1 fingerprint: 8c:f4:27:fd:79:0c:3a:d1:66:06:8d:e8:1e:57:ef:bb:93:22:72:d4 cn = entrust root certification authority - ec1 sha1 fingerprint: 20:d8:06:40:df:9b:25:f5:12:25:3a:11:ea:f7:59:8a:eb:14:b5:47 cn = cfca ev root sha1 fingerprint: e2:b8:29:4b:55:84:ab:6b:58:c2:90:46:6c:ac:3f:b8:39:8f:84:83 the version number of the updated root ca list has been set to 2.3 bugs fixed in nss 3.18 this bugzilla query returns all the bugs fixed in nss 3.18: https://bugzilla.mozilla.org/buglist.cgi?resolution=fixed&classification=components&query_format=advanced&product=nss&target_milestone=3.18 compatibility nss 3.18 shared libraries are backward compatible with all older nss 3.x shared libraries.
NSS 3.19.2.2 release notes
(current users of nss 3.19.3 or nss 3.19.4 are advised to update to nss 3.20.2, nss 3.21, or a later release.) distribution information the hg tag is nss_3_19_2_2_rtm.
NSS 3.19.2.3 release notes
(current users of nss 3.19.3, nss 3.19.4 or nss 3.20.x are advised to update to nss 3.21.1, nss 3.22.2, or a later release.) distribution information the hg tag is nss_3_19_2_3_rtm.
NSS 3.19.2.4 release notes
(current users of nss 3.19.3, nss 3.19.4 or nss 3.20.x are advised to update to nss 3.21.1, nss 3.22.2 or a later release.) distribution information the hg tag is nss_3_19_2_4_rtm.
NSS 3.19 release notes
nss now more strictly validates tls extensions and will fail a handshake that contains malformed extensions (bug 753136).
NSS 3.20 release notes
nss no longer supports c compilers that predate the ansi c standard (c89).
NSS 3.22 release notes
ckp_pkcs5_pbkd2_hmac_sha512_224 - prf based on hmac with sha-512 truncated to 224 bits for pbkdf (not supported) ckp_pkcs5_pbkd2_hmac_sha512_256 - prf based on hmac with sha-512 truncated to 256 bits for pbkdf (not supported) in secoidt.h nss_use_alg_in_ssl nss_use_policy_in_ssl in ssl.h ssl_enable_signed_cert_timestamps in sslt.h ssl_max_extensions is updated to 13 notable changes in nss 3.22 nss c++ tests are built by default, requiring a c++11 compiler.
NSS 3.23 release notes
notable changes in nss 3.23 the copy of sqlite shipped with nss has been updated to version 3.10.2 (bug 1234698) the list of tls extensions sent in the tls handshake has been reordered to increase compatibility of the extended master secret with servers (bug 1243641) the build time environment variable nss_enable_zlib has been renamed to nss_ssl_enable_zlib (bug 1243872).
NSS 3.25 release notes
the trusted ca certificate list has been updated to version 2.8.
NSS 3.27 release notes
added support for rsa-pss signatures in tls 1.2 and tls 1.3 new functions in ssl.h ssl_namedgroupconfig notable changes in nss 3.27 update 2016-10-02: the maximum tls version supported has been increased to tls 1.3 (draft).
NSS 3.39 release notes
the ca certificates list was updated to version 2.26.
NSS 3.44.1 release notes
xed in nss 3.44.1 1554336 - optimize away unneeded loop in mpi.c 1515342 - more thorough input checking (cve-2019-11729) 1540541 - don't unnecessarily strip leading 0's from key material during pkcs11 import (cve-2019-11719) 1515236 - add a sslkeylogfile enable/disable flag at build.sh 1473806 - fix seckey_converttopublickey handling of non-rsa keys 1546477 - updates to testing for fips validation 1552208 - prohibit use of rsassa-pkcs1-v1_5 algorithms in tls 1.3 (cve-2019-11727) 1551041 - unbreak build on gcc < 4.3 big-endian compatibility nss 3.44.1 shared libraries are backward compatible with all older nss 3.x shared libraries.
NSS 3.44.3 release notes
bugs fixed in nss 3.44.3 bug 1579060 - don't set the constructed bit for issueruniqueid and subjectuniqueid in mozilla::pkix cve-2019-11745 - encryptupdate should use maxout, not block size this bugzilla query returns all the bugs fixed in nss 3.44: https://bugzilla.mozilla.org/buglist.cgi?resolution=fixed&classification=components&query_format=advanced&product=nss&target_milestone=3.44 compatibility nss 3.44.3 shared libraries are backward compatible with all older nss 3.x shared libraries.
NSS 3.46 release notes
itialized warning in lgattr.c bug 1561558 - remove -wmaybe-uninitialized warning in httpserv.c bug 1561556 - remove -wmaybe-uninitialized warning in tls13esni.c bug 1561332 - ec.c:28 warning: comparison of integers of different signs: 'int' and 'unsigned long' bug 1564714 - print certutil commands during setup bug 1565013 - hacl image builder times out while fetching gpg key bug 1563786 - update hacl-star docker image to pull specific commit bug 1559012 - improve gcm perfomance using pmull2 bug 1528666 - correct resumption validation checks bug 1568803 - more tests for client certificate authentication bug 1564284 - support profile mobility across windows and linux bug 1573942 - gtest for pkcs11.txt with different breaking line formats bug 1575968 - add strsclnt option to enforce t...
NSS 3.47.1 release notes
bugs fixed in nss 3.47.1 cve-2019-11745 - encryptupdate should use maxout, not block size bug 1590495 - fix a crash that could be caused by client certificates during startup bug 1589810 - fix compile-time warnings from uninitialized variables in a perl script this bugzilla query returns all the bugs fixed in nss 3.47: https://bugzilla.mozilla.org/buglist.cgi?resolution=fixed&classification=components&query_format=advanced&product=nss&target_mile...
NSS 3.47 release notes
2625 - support aes hw acceleration on armv8 bug 1267894 - allow per-socket run-time ordering of the cipher suites presented in clienthello bug 1570501 - add cmac to freebl and pkcs #11 libraries bugs fixed in nss 3.47 bug 1459141 - make softoken cbc padding removal constant time bug 1589120 - more cbc padding tests bug 1465613 - add ability to distrust certificates issued after a certain date for a specified root cert bug 1588557 - bad debug statement in tls13con.c bug 1579060 - mozilla::pkix tag definitions for issueruniqueid and subjectuniqueid shouldn't have the constructed bit set bug 1583068 - nss 3.47 should pick up fix from bug 1575821 (nspr 4.23) bug 1152625 - support aes hw acceleration on armv8 bug 1549225 - disable dsa signature schemes for tls 1.3 bug 1586947 - pk11_...
NSS Sample Code
see https://bugzilla.mozilla.org/show_bug.cgi?id=490238 you are welcome to download the new samples via: hg clone https://hg.mozilla.org/projects/nss; cd nss; hg update samples_branch the new samples: /docs/mozilla/projects/nss/new_nss_samples ...
nss tech note3
when nss is asked to verify the validity of a certificate chain, it verifies the validity of that cert chain for a particular purpose, known as a seccertusage, as of a specific date and time.
nss tech note4
myoiditem = { (secitemtype) 0, (unsigned char *)myoid, sizeof(myoid) }; secitem myextvalue; mycertextdata data; secstatus rv = cert_findcertextensionbyoid(cert, &myoiditem, &myextvalue); if (rv == secsuccess) { sec_asn1decodercontext * context = sec_asn1decoderstart(null, &data, mycertexttemplate); rv = sec_asn1decoderupdate( context, (const char *)(myextvalue.data), myextvalue.len); if (rv == secsuccess) { /* now you can extract info from secitem fields of your extension data structure */ /* see "misc helper functions" below */ .......
nss tech note6
the softoken and freebl binaries won't match any nss binaries that may have been submitted to nist for validation, and thus may not be verified as being the actual fips 140 validated cryptographic module .
New NSS Samples
see https://bugzilla.mozilla.org/show_bug.cgi?id=490238 how to download the samples: hg clone https://hg.mozilla.org/projects/nss; cd nss; hg update samples_branch samples list: sample code 1: hashing sample code 2: init nss database sample code 3: encrypt/decrypt and mac using token sample code 4: encrypt/decrypt and mac using session objects sample code 5: encrypt/decrypt/mac output public key as a csr sample code 6: encrypt/decrypt/mac generating a pkcs#11 csr common code used by these samples: sample code 0: utilities th...
Overview of NSS
fips 140 validation and niscc testing the nss software crypto module has been validated three times for conformance to fips 140 at security levels 1 and 2.
PKCS11 FAQ
MozillaProjectsNSSPKCS11FAQ
you must update all sessions correctly when the state changes.
PKCS11 Implement
this note will be removed once the document is updated for the current version of nss.
PKCS 12 functions
sec_pkcs12decoderimportbags mxr 3.2 and later sec_pkcs12decoderiterateinit mxr 3.10 and later sec_pkcs12decoderiteratenext mxr 3.10 and later sec_pkcs12decodersettargettokencas mxr 3.8 and later sec_pkcs12decoderstart mxr 3.2 and later sec_pkcs12decoderupdate mxr 3.2 and later sec_pkcs12decodervalidatebags mxr 3.2 and later sec_pkcs12decoderverify mxr 3.2 and later sec_pkcs12destroyexportcontext mxr 3.2 and later sec_pkcs12enablecipher mxr 3.2 and later sec_pkcs12encode mxr 3.2 and later ...
Installation guide
the build system of nss originated from netscape's build system, which predated the "configure; make; make test; make install" sequence that we're familiar with now.
FC_SignFinal
return value examples see also fc_signupdate, nsc_signfinal ...
FC_SignInit
return value examples see also nsc_signinit fc_sign fc_signupdate fc_signfinal ...
FC_VerifyFinal
return value examples see also fc_verifyupdate, nsc_verifyfinal ...
NSS tools : pk12util
led o 2 - usage error o 6 - nls init error o 8 - certificate db open error o 9 - key db open error o 10 - file initialization error o 11 - unicode conversion error o 12 - temporary file creation error o 13 - pkcs11 get slot error o 14 - pkcs12 decoder start error o 15 - error read from import file o 16 - pkcs12 decode error o 17 - pkcs12 decoder verify error o 18 - pkcs12 decoder validate bags error o 19 - pkcs12 decoder import bags error o 20 - key db conversion version 3 to version 2 error o 21 - cert db conversion version 7 to version 5 error o 22 - cert and key dbs patch error o 23 - get default cert db error o 24 - find cert by nickname error o 25 - create export context error o 26 - pkcs12 add password itegrity error o 27 - cert and key safes creation error o 28 - ...
NSS tools : vfychain
options -a the following certfile is base64 encoded -b yymmddhhmmz validate date (default: now) -d directory database directory -f enable cert fetching from aia url -o oid set policy oid for cert validation(format oid.1.2.3) -p use pkix library to validate certificate by calling: * cert_verifycertificate if specified once, * cert_pkixverifycert if specified twice and more.
troubleshoot.html
if the build fails early on the gmakein coreconf try updating your cvs tree with -p: cd mozilla cvs update -p building a 32-bit version on a 64-bit may fail with: /usr/include/features.h:324:26: fatal error: bits/predefs.h: no such file or directory in this case remember to set use_64=1 testing nss the ssl stress test opens 2,048 tcp connections in quick succession.
OLD SSL Reference
n ssl_authcertificatehook ssl_authcertificate ssl_badcerthook ssl_getclientauthdatahook nss_getclientauthdata ssl_handshakecallback ssl communication functions ssl_invalidatesession ssl_datapending ssl_securitystatus ssl_getsessionid ssl_setsockpeerid ssl functions used by callbacks ssl_peercertificate ssl_revealurl ssl_revealpinarg ssl handshake functions ...
sslcrt.html
validating certificates manipulating certificates getting certificate information comparing secitem objects validating certificates cert_verifycertnow cert_verifycertname cert_checkcertvalidtimes nss_cmpcertchainwcanames cert_verifycertnow checks that the current date is within the certificate's validity period and that the ca signature on the certificate is valid.
sslerr.html
rforming this operation." sec_error_ocsp_malformed_response -8063 "the response from the ocsp server was corrupted or improperly formed." sec_error_ocsp_unauthorized_response -8062 "the signer of the ocsp response is not authorized to give status for this certificate." sec_error_ocsp_future_response -8061 "the ocsp response is not yet valid (contains a date in the future)." sec_error_ocsp_old_response -8060 "the ocsp response contains out-of-date information." sec_error_digest_not_found -8059 "the cms or pkcs #7 digest was not found in signed message." sec_error_unsupported_message_type -8058 "the cms or pkcs #7 message type is unsupported." sec_error_module_stuck -8057 "pkcs #11 module cou...
sslintro.html
functions that can be used by both clients and servers during communication include the following: pr_send or pr_write pr_read or pr_recv pr_geterror pr_getpeername pr_sleep pr_malloc pr_free pr_poll pr_now pr_intervaltomilliseconds pr_millisecondstointerval pr_shutdown pr_close ssl_invalidatesession after establishing a connection, an application first calls pr_send, pr_recv, pr_read, pr_write, or ssl_forcehandshake to initiate the handshake.
SSL functions
ssl_getclientauthdatahook mxr 3.2 and later ssl_getmaxservercachelocks mxr 3.4 and later ssl_getsessionid mxr 3.2 and later ssl_getstatistics mxr 3.2 and later ssl_handshakecallback mxr 3.2 and later ssl_importfd mxr 3.2 and later ssl_inheritmpserversidcache mxr 3.2 and later ssl_invalidatesession mxr 3.2 and later ssl_localcertificate mxr 3.4 and later ssl_optionget mxr 3.2 and later ssl_optiongetdefault mxr 3.2 and later ssl_optionset mxr 3.2 and later ssl_optionsetdefault mxr 3.2 and later ssl_peercertificate mxr 3.2 and later ssl_preencryptedfiletostream mxr 3.2 and lat...
NSS Tools dbck-tasks
the dbck tool should be able to update a databa ...
NSS Tools pk12util-tasks
nss security tools: pk12util tasks newsgroup: mozilla.dev.tech.crypto task list need to migrate code to use an up-to-date version of nss.
NSS Tools pk12util
ng values: 0 - no error 1 - user cancelled 2 - usage error 6 - nls init error 8 - certificate db open error 9 - key db open error 10 - file initialization error 11 - unicode conversion error 12 - temporary file creation error 13 - pkcs11 get slot error 14 - pkcs12 decoder start error 15 - error read from import file 16 - pkcs12 decode error 17 - pkcs12 decoder verify error 18 - pkcs12 decoder validate bags error 19 - pkcs12 decoder import bags error 20 - key db conversion version 3 to version 2 error 21 - cert db conversion version 7 to version 5 error 22 - cert and key dbs patch error 23 - get default cert db error 24 - find cert by nickname error 25 - create export context error 26 - pkcs12 add password itegrity error 27 - cert and key safes creation error 28 - pkcs12 add cert and key error ...
NSS tools : pk12util
- certificate db open error o 9 - key db open error o 10 - file initialization error o 11 - unicode conversion error o 12 - temporary file creation error o 13 - pkcs11 get slot error o 14 - pkcs12 decoder start error o 15 - error read from import file o 16 - pkcs12 decode error o 17 - pkcs12 decoder verify error o 18 - pkcs12 decoder validate bags error o 19 - pkcs12 decoder import bags error o 20 - key db conversion version 3 to version 2 error o 21 - cert db conversion version 7 to version 5 error o 22 - cert and key dbs patch error o 23 - get default cert db error o 24 - find cert by nickname error o 25 - create export context error o 26 - pkcs12 add password itegrity error o 27...
NSS tools : vfychain
options -a the following certfile is base64 encoded -b yymmddhhmmz validate date (default: now) -d directory database directory -f enable cert fetching from aia url -o oid set policy oid for cert validation(format oid.1.2.3) -p use pkix library to validate certificate by calling: * cert_verifycertificate if specified once, * cert_pkixverifycert if specified twice and more.
Necko FAQ
todo original document information author(s): gagan saksena last updated date: december 21, 2001 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
The Necko HTTP module
original document information last updated date: may 12, 2003 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details ...
Proxies in Necko
original document information author(s): christian biesinger last updated date: april 8, 2005 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Pork
please refer to the oink link below for a more up-to-date toolchain.
Download Rhino
binaries release release date change log download link rhino 1.7r4 2012-06-18 new in rhino 1.7r4 rhino1_7r4.zip rhino 1.7r5 2015-01-29 release notes rhino1_7r5.zip rhino 1.7.6 2015-04-15 release notes rhino1.7.6.zip rhino 1.7.7 2015-06-17 release notes rhino1.7.7.zip rhino 1.7.7.1 2016-02-01 release notes rhino1.7.7.1.zip rhino 1.7.7.2 2017-08-24 release notes rhino1.7.7.2.zip rhino 1.7.8 2018-01-22 release notes rhino1.7.8.zip rhino 1.7.9 2018-03-15 release notes rhino1.7.9.zip rhino 1.7.10 2018-04-09 release notes rhino1.7.10.zip ...
Rhino downloads archive
release release date change log download link rhino 1.7r4 2012-06-18 new in rhino 1.7r4 rhino1_7r4.zip rhino 1.7r3 2011-05-09 new in rhino 1.7r3 rhino1_7r3.zip rhino 1.7r2 2009-03-22 new in rhino 1.7r2 rhino1_7r2.zip rhino 1.7r1 2008-03-06 new in rhino 1.7r1 rhino1_7r1.zip rhino 1.6r7 2007-08-20 new in rhino 1.6r7 rhino1_6r7.zip rhino 1.6r6 2007-07-30 new in rhino 1.6r6 rhino1_6r6.zip rhino 1.6r5 2006-11-19 same code as 1.6r4, but relicensed under mpl/gpl.
New in Rhino 1.7R4
update license to mpl 2.0 make string concatenation with + fast java class generation updates and fixes faster number to string conversion several regexp fixes regexp performance improvements es5 compliance fixes improved interpreter performance improved commonjs module implementation javascript 1.8 generator expressions many parser and ast fixes use javascript 1.7 as default version in rhino shell javaadapter improvements fixes in js to java access include mozilla test suite a list of bugs that were fixed since the previous release.
Rhino serialization
original document information author: norris boyd last updated date: november 15, 2006 copyright information: portions of this content are © 1998–2006 by individual mozilla.org contributors; content available under a creative commons license | details.
SpiderMonkey Build Documentation
first, download a spidermonkey source distribution, such as spidermonkey 1.8 release candidate 1.
Creating JavaScript jstest reftests
an update script exists in the js/src/tests directories to fetch and reformat the test262 suite, see test262-update.py.
GC Rooting Guide
a js::handle<t> is a reference to a js::rooted<t>, and is created implicitly by referencing a js::rooted<t>: it is not valid to create a js::handle<t> manually (the whole point of a handle is that it only reference pointers that the gc knows about so it can update them when they move).
Bytecode Descriptions
for example, in with (date) { getfullyear(); }, the implicit this passed to getfullyear is date, not undefined.
Exact Stack Rooting
the method you should use to keep the gc up-to-date with this information will vary depending on where the gcpointer is being stored.
Property cache
when a prototype gains a property that could invalidate an entry of this type, rt->protohazardshape is bumped, effectively marking all such entries invalid at once.
Introduction to the JavaScript shell
build() returns the date and time at which the javascript shell was built.
JSGetObjectOps
thus jsclass (which pre-dates jsobjectops in the api) provides a low-level interface to class-specific code and data, while jsobjectops allows for a higher level of operation, which does not use the object's class except to find the class's jsobjectops struct, by calling clasp->getobjectops, and to finalize the object.
JSPropertyOp
if the property has a stored value, it is then updated to the value left in *vp after the callback.
JSProtoKey
mxr search for jsproto_null jsproto_object object mxr search for jsproto_object jsproto_function function mxr search for jsproto_function jsproto_array array mxr search for jsproto_array jsproto_boolean boolean mxr search for jsproto_boolean jsproto_json json mxr search for jsproto_json jsproto_date date mxr search for jsproto_date jsproto_math math mxr search for jsproto_math jsproto_number number mxr search for jsproto_number jsproto_string string mxr search for jsproto_string jsproto_regexp regexp mxr search for jsproto_regexp jsproto_error error mxr search for jsproto_error jsproto_inter...
JS_DefaultValue
objects with classes defined by ecmascript itself all use the [[defaultvalue]] algorithm specified in §8.12.8 (but note the algorithm's special case for date objects).
JS_GetGCParameter
jsgc_pretenure_threshold / "pretenurethreshold" if this percentage of the nursery is tenured and the nursery is at least 4mb, then process object groups to look for pretenuring candidates.
JS_GetImplementationVersion
syntax const char * js_getimplementationversion(void); description js_getimplementationversion returns a hard-coded, english language string that specifies the version number of the js engine currently in use, and its release date.
JS_GetParent
for example, after d = new date, d has the same parent as date, ordinarily the global object.
JS_InitStandardClasses
these include all the standard ecmascript global properties defined in ecma 262-3 §15.1: array, boolean, date, decodeuri, decodeuricomponent, encodeuri, encodeuricomponent, error, eval, evalerror, function, infinity, isnan, isfinite, math, nan, number, object, parseint, parsefloat, rangeerror, referenceerror, regexp, string, syntaxerror, typeerror, undefined, and urierror as well as a few spidermonkey-specific globals, depending on compile-time options: escape, unescape, uneval, internalerror, scrip...
JS_SetDefaultLocale
description js_setdefaultlocale sets the default locale for the ecmascript internationalization api (intl.collator, intl.numberformat, intl.datetimeformat).
JS_SetInterruptCallback
some common uses for an interrupt callback are: to run garbage collection periodically, by calling js_maybegc; to periodically take a break from script execution to update the ui (though note that mozilla does not do this, by design); to enforce application limits on the amount of time a script may run.
JS_SetOperationCallback
some common uses for an operation callback are: to run garbage collection periodically, by calling js_maybegc; to periodically take a break from script execution to update the ui (though note that mozilla does not do this, by design); to enforce application limits on the amount of time a script may run.
JS_ShutDown
implementation note: this method has been used to clean up memory allocated by jsdtoa.cpp, memory allocated to implement date.now() on windows, and when the internationalization api is enabled, memory internally allocated by icu.
Stored value
the stored value is updated each time the program gets or sets the property.
SpiderMonkey 1.8
the mozilla javascript team is pleased to announce the release of spidermonkey 1.8 release candidate 1.
SpiderMonkey 17
new javascript language features javascript 17 includes significant updates to language features, yo.
Setting up CDT to work on SpiderMonkey
step 2 - installing eclipse and setting up the project the following run-down is a condensed and updated version of what is explained in much more detail for the entire mozilla codebase.
TPS Tests
this test generally validates your tps setup and does a light test of a few engines.
Mozinfo
because information is not consolidated, checks are not done consistently, nor is it defined what we are checking for.
Exploitable crashes
it hasn't been updated since 2009.
Secure Development Guidelines
ing function pointer a vulnerability is required to modify the eip or sensitive memory saved return addr or function pointer get altered introduction: gaining control (3) common issues used to gain control buffer overflows format string bugs integer overflows/underflows writing secure code: input validation input validation most vulnerabilities are a result of un-validated input always perform input validation could save you without knowing it examples: if it doesn’t have to be negative, store it in an unsigned int if the input doesn’t have to be > 512, cut it off there if the input should only be [a-za-z0-9], enforce it cross site scripting (xss) xss is a type of code injection attack typically occurs in web applications injection o...
Security and the jar protocol
inotes has since been updated so that it no longer needs remote jars, so they have been disabled again in firefox 55.
Handling Mozilla Security Bugs
in practice, if over time a particular person happens to be frequently added to the cc list for security-sensitive bugs, then they would be a good candidate to be invited to join the security bug group.
Animated PNG graphics
MozillaTechAPNG
removed num_frames from 'anim' chunk from 0.3 added 'actl', 'fdat', 'fctl' chunk descriptions as per the latest png-list discussion added section 4, "interactions with other png chunks"; described global and local palettes and transparency changed 'offs' chunk section to refer to more general chunks updated 'adat' description to indicate that all frames must either be in a single chunk, or that the first chunk must have empty data.
Gecko events
event_text_updated text was updated.
Gecko states
multi_line edit control that can take multiple lines ext_state_horizontal uses horizontal layout ext_state_opaque indicates this object paints every pixel within its rectangular region ext_state_single_line this text object can only contain 1 line of text ext_state_transient ext_state_vertical especially used for sliders and scrollbars ext_state_stale object not dead, but not up-to-date either ext_state_enabled a widget that is not unavailable ext_state_sensitive same as enabled for now ext_state_expandable if collapsed or expanded ...
Implementation Details
mutation events should be watched to invalidate the cache.
XForms Accessibility
checkbox - see the docs datepicker - see the docs.
The Places database
it contains the date, referrer, and other information specific to that visit.
Places utilities for JavaScript
warning: the content of this article may be out of date.
places.sqlite Database Troubleshooting
nn must be replaced with the number we had noted previously: sqlite> pragma user_version = nn; let's update the page_size value: sqlite> pragma journal_mode = truncate; sqlite> pragma page_size = 32768; sqlite> vacuum; sqlite> pragma journal_mode = wal; sqlite> .exit copy the new places.sqlite to the profile folder, overwriting the existing one.
The Publicity Stream API
getpublicitystream( onsuccess: <function>, { [ onerror: <function> ], [ for_apps: <list> ], [ since: <date> ], [ before: <date> ], [ count: <int> ]): provides a means for a web store to receive a list of the current user's socially relevant app activity by being called from an origin which hosts a web store.
Toolkit API
these services include: profile management chrome registration browsing history extension and theme management application update service safe mode printing official references structure of an installable bundle: describes the common structure of installable bundles, including extensions, themes, and xulrunner applications extension packaging: specific information about how to package extensions theme packaging: specific information about how to package themes multiple-item extension packaging: specific information about multiple-item extension xpis xul application packaging: specific information about how to package x...
Fun With XBL and XPConnect
<handlers> <handler type="keypress" keycode="vk_return" value="autocomplete(anonymouscontent[0].value, this.autocompletelistener);"/> </handlers> </implementation> </binding> original document information author(s): scott macgregor last updated date: april 13, 2000 copyright information: copyright (c) scott macgregor ...
Generating GUIDs
sfink's update-uuids will change the uuid for a given interface and all of its descendants, updating all *.idl files within a directory tree.
Generic factory
original document information author: patrick beard last updated date: february 26, 1999 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Avoiding leaks in JavaScript XPCOM components
this article needs to be updated to reflect the changes and the cases where they help.
An Overview of XPCOM
updates you can update components without having to recompile the whole application.
Preface
it is badly out of date, and much of what it says is either no longer remotely accurate, or is severely deprecated.
Setting up the Gecko SDK
the makefile allows you to specify any number of options for your build environment, including the path and configuration updates you need to build with the gecko sdk.
XPCOM guide
MozillaTechXPCOMGuide
this article details those changes, and provides suggestions for how to update your code.xpcom hashtable guidea hashtable is a data construct that stores a set of items.
Interfacing with the XPCOM cycle collector
in this stage the collector repeatedly asks each candidate for a singleton cycle-collection helper class, and if that helper exists, the collector asks the helper to describe the candidate's (owned) children.
Components.utils.createObjectIn
example to create a new object in the scope of a specified dom window, you can simply do: function genpropdesc(value) { return { enumerable: true, configurable: true, writable: true, value: value }; } var myobject = components.utils.createobjectin(mywindow); var proplist = { name: genpropdesc("name"), date: genpropdesc("date"), id: genpropdesc("id"), func: genpropdesc(function() { alert("called func!"); }) }; object.defineproperties(myobject, proplist); components.utils.makeobjectpropsnormal(myobject); this sets up the new object in the scope of the object mywindow, then adds properties by calling object.defineproperties(), then normalizes them by calling components.utils.makeobjectpropsnorm...
PyXPCOM
please update this page if/when the links can be found.
Profiling XPCShell
a profile will look like this: file:///users/michiel/mozilla/tree1/...js/calutils.js [2,25420] createdatetime() {60-62} 579 {min 0, max 3, avg 0, sum 427, self 427} [2,56810] cp_qi() {860-866} 835 {min 0, max 1, avg 0, sum 950, self 950} the first line tells which file was profiled.
XPCShell Reference
original document information author: david bradley <dbradley@netscape.com> last updated date: 17 march 2003 copyright information: portions of this content are © 1998–2008 by individual mozilla.org contributors; content available under a creative commons license.
Folders
folders have a number of interesting attributes: parent subfolder server uri flags and methods getdatabase ( how to get a database of the messages in the folder.) updatefolder (gets new messages for that folder, if applicable, e.g., pop3 inboxes, imap folders, news folders, rss folders) ...
IAccessible2
thus, if there's a reorder/show/hide event the at knows which part of the internal structure has been invalidated and can refetch just that part.
IAccessibleTable
[propget] hresult modelchange( [out] ia2tablemodelchange modelchange ); parameters modelchange a struct of (type(insert, delete, update), firstrow, lastrow, firstcolumn, lastcolumn).
IAccessibleTable2
[propget] hresult modelchange( [out] ia2tablemodelchange modelchange ); parameters modelchange a struct of (type(insert, delete, update), firstrow, lastrow, firstcolumn, lastcolumn).
imgIRequest
if an html img element has the crossorigin attribute set, the imgirequest will be validated for cross-origin usage with cors, and, if successful, will have its cors mode set to the relevant type.
inIDOMUtils
parsestylesheet() parse css and update the style sheet in place.
mozITXTToHTMLConv
remarks you can call this method repeatedly, passing in updated values for apos, to locate all the urls in a string.
mozIThirdPartyUtil
this represents the case where a toplevel load is occurring and the window's uri has not yet been updated.
mozIVisitInfo
visitdate prtime read only: the time the visit occurred.
nsIAccessibleEvent
event_text_updated 0x0037 0x0033 text was updated.
nsIAccessibleProvider
xformsinputdate 0x00002006 used for input[xsd:date] element.
nsIAccessibleStates
ext_state_stale 0x00001000 object not dead, but not up-to-date either.
nsIBlocklistService
nsiplugintag plugin, [optional] in astring appversion, [optional] in astring toolkitversion); boolean isaddonblocklisted(in jsval addon, [optional] in astring appversion, [optional] in astring toolkitversion); constants constant value description state_not_blocked 0 state_softblocked 1 state_blocked 2 state_outdated 3 methods getaddonblockliststate() determine the blocklist state of an add-on.
nsICacheEntryDescriptor
markvalid() this method means that a writer must validate this cache object before any readers are given a descriptor to the object.
nsIContentSecurityPolicy
refinepolicy() updates the policy currently stored in the content security policy to be "refined" or tightened by the one specified in the string policystring.
nsICookieManager2
aexpiry holds the expiration date, in seconds since the epoch.
nsICookieStorage
acookiebuffer buffer large enough to accommodate cookie data.
nsIDBChangeListener
common events should be documented here so we have a hope of keeping the documentation up to date.
nsIDBFolderInfo
rtystr); void setuint32property(in string propertyname, in unsigned long propertyvalue); attributes attribute type description charactersetoverride boolean expiredmark nsmsgkey expungedbytes long flags long folderdate unsigned long foldername string foldersize unsigned long highwater nsmsgkey imaphierarchyseparator wchar imaptotalpendingmessages long imapuidvalidity long imapunreadpendingmessages l...
nsIDOMGeoGeolocation
watchposition() similar to getcurrentposition(), except it continues to call the callback with updated position information periodically until clearwatch() is called.
nsIDOMMozNetworkStatsData
date date the date of the sample.
nsIDOMParser
if you come across a situation when these matter, feel free to ask questions in mozilla.dev.tech.dom and update this documentation to mention these cases.
nsIDOMXPathResult
for example, modifying a node invalidates the iterator.
nsIDeviceMotionListener
void onmotionchange( in nsidevicemotiondata amotiondata ); parameters aacceleration the nsidevicemotiondata object describing updated motion information.
nsIDragService
this is used on mac and windows to update the position of a popup being used as a drag image during the drag operation.
nsIEffectiveTLDService
the tld space is currently expanding at a fairly great rate, and the copy of the psl firefox has may not be totally up to date (because it's not dynamically updated data).
nsIEnumerator
} iter.next(); } while( components.lastresult == 0 ); } catch(e) {} search for e-mail from "warren harris" dated 04/21/1999 time 16:11:03 for some notes on the subject.
ExtensionManager (Toolkit)
examples here is how to retrive all the extensions installed: var em = cc['@mozilla.org/extensions/manager;1'] .getservice(ci.nsiextensionmanager); const nsiupdateitem = ci.nsiupdateitem; var extension_type = nsiupdateitem.type_extension; items = em.getitemlist(extension_type, {}); items.foreach(function(item, index, array) { alert(item.name + " / " + item.id + " version: " + item.version); }); ...
nsIFTPChannel
last changed in gecko 1.9 (firefox 3) inherits from: nsisupports attributes attribute type description lastmodifiedtime prtime the time at which the ftp channel was last updated.
nsIFeedContainer
updated astring a string containing the date the feed or entry was last updated, in rfc822 form.
nsIFilePicker
for the most up to date list see filepicker.properties.
nsIFocusManager
instead, just update the focus within that window and leave the application focus as is.
nsIHttpChannel
equivalent response headers include: "pragma: no-cache", "expires: 0", and "expires" with a date value in the past relative to the value of the "date" header.
nsIHttpChannelInternal
setcookie() helper method to set a cookie with a consumer-provided cookie header, but using the channel's other information (uri's, prompters, date headers and so on.).
nsILocalFile
pr_sync if set, each write will wait for both the file data and file status to be physically updated.
Building an Account Manager Extension
function onpreinit(account, accountvalues) { } function oninit(pageid, serverid) { } function onaccepteditor() { } function onsave() { } function updatepage() {} step5: putting it all together // todo build an demo extension for this tutorial...
nsIMsgFilterCustomAction
* @param actionfolder folder in the filter list * @param filtertype filter type (manual, offlinemail, etc.) * * @return errormessage a localized message to display if invalid * set to null if the actionvalue is valid */ autf8string validateactionvalue(in autf8string actionvalue, in nsimsgfolder actionfolder, in nsmsgfiltertypetype filtertype); /* allow duplicate actions in the same filter list?
nsIMsgIdentity
signaturedate long escapedvcard astring dofcc boolean fccfolder astring fccfolderpickermode astring fccreplyfollowsparent boolean draftsfolderpickermode astring tmplfolderpickermode astring bccself boolean note: don't call bccself, bccothers, and bcclist directly, they a...
nsIMsgSearchTerm
attribute acstring customid; beginsgrouping attribute boolean beginsgrouping; endsgrouping attribute boolean endsgrouping; methods matchrfc822string boolean matchrfc822string(in string astring, in string charset, in boolean charsetoverride); matchrfc2047string boolean matchrfc2047string(in string astring, in string charset, in boolean charsetoverride); matchdate boolean matchdate(in prtime atime); matchstatus boolean matchstatus(in unsigned long astatus); matchpriority boolean matchpriority(in nsmsgpriorityvalue priority); matchage boolean matchage(in prtime days); matchsize boolean matchsize(in unsigned long size); matchlabel boolean matchlabel(in nsmsglabelvalue alabelvalue); matchjunkstatus boolean matchjunkstatus(in string ajunkscor...
nsIMsgSearchValue
attribute astring str; attribute nsmsgpriorityvalue priority; attribute prtime date; // see nsmsgmessageflags.idl and nsmsgfolderflags.idl attribute unsigned long status; attribute unsigned long size; attribute nsmsgkey msgkey; attribute long age; // in days attribute nsimsgfolder folder; attribute nsmsglabelvalue label; attribute nsmsgjunkstatus junkstatus; /* * junkpercent is set by the message filter plugin, and is approximately ...
nsIMsgThread
subject acstring subject of the thread newestmsgdate unsigned long numchildren unsigned long readonly: number of messages in the thread.
nsIMsgWindowCommands
mailnews/base/public/nsimsgwindow.idlscriptable this interface defines methods used by the back end to update the user interface in a mail or news message list.
nsINavHistoryContainerResultNode
for queries and bookmark folders, however, being open means they must keep themselves up-to-date by listening for updates and re-querying as needed.
nsINavHistoryQuery
javascript date objects are expressed in milliseconds since 1 jan 1970.
nsINavHistoryResultTreeViewer
when you sort by date, the multiple entries will then appear because they will be separated (unless you clicked reload a bunch of times in a row).
nsINavHistoryService
you should use the new async api moziasynchistory.updateplaces() instead.
nsIPlacesView
this may be modified dynamically to update the view.
nsIProtocolProxyService
if the filter is already registered, then its position will be updated.
nsISmsService
timestamp a date object with the timestamp of the message.
nsITelemetry
see also bug 649502 - expose histograms to js bug 585196 - telemetry infrastructure bug 668312 - report only probes defined in histograms.json bug 1069874 - add keyed histogram types bug 1426453 - documentation of nsitelemetry not up to date ...
nsITextInputProcessor
this means that even when gecko changes the dom event behavior, it may not be necessary that the users of this interface need to be updated, i.e., the implementation of this class can be a cushion from the impact of gecko's change.
nsIUrlListManagerCallback
toolkit/components/url-classifier/public/nsiurllistmanager.idlscriptable interface for a class that manages updates of the url classifier database.
nsIWebBrowserChrome
setstatus() called when the status text in the chrome needs to be updated.
nsIWebBrowserChrome2
1.0 66 introduced gecko 1.9 inherits from: nsiwebbrowserchrome last changed in gecko 1.9 (firefox 3) method overview void setstatuswithcontext(in unsigned long statustype, in astring statustext, in nsisupports statuscontext); methods setstatuswithcontext() called when the status text in the chrome needs to be updated.
nsIWebNavigation
load_flags_bypass_history 64 this flag specifies that history should not be updated.
nsIXMLHttpRequest
using event handlers from native code (not sure if it's up-to-date) from native code, the way to set up onload and onerror handlers is a bit different.
nsIXULBrowserWindow
xpfe/appshell/public/nsixulbrowserwindow.idlscriptable provides methods that may be called from the internals of the browser area to tell the containing xul window to update its user interface.
nsIXULWindow
xulbrowserwindow nsixulbrowserwindow provides access to the xulbrowserwindow object offering a way for the browser to update the user interface of the enclosing xul window.
nsMsgRuleActionType
defined in comm-central/ mailnews/ base/ search/ public/ nsmsgfiltercore.idl typedef long nsmsgruleactiontype; [scriptable, uuid(59af7696-1e28-4642-a400-fa327ae0b8d8)] interface nsmsgfilteraction { /* if you change these, you need to update filter.properties, look for filteractionx */ /* these longs are all actually of type nsmsgfilteractiontype */ const long custom=-1; /* see nsmsgfilteraction */ const long none=0; /* uninitialized state */ const long movetofolder=1; const long changepriority=2; const long delete=3; const long markread=4; const long killthread=5; const long watchthread=6; const long markflagged=7; const long label=8; const long reply=9; const long forward=10; const long stopexecution=11;...
nsMsgSearchAttrib
(a83ca7e8-4591-4111-8fb8-fd76ac73c866)] interface nsmsgsearchattrib { const nsmsgsearchattribvalue custom = -2; /* a custom term, see nsimsgsearchcustomterm */ const nsmsgsearchattribvalue default = -1; const nsmsgsearchattribvalue subject = 0; /* mail and news */ const nsmsgsearchattribvalue sender = 1; const nsmsgsearchattribvalue body = 2; const nsmsgsearchattribvalue date = 3; const nsmsgsearchattribvalue priority = 4; /* mail only */ const nsmsgsearchattribvalue msgstatus = 5; const nsmsgsearchattribvalue to = 6; const nsmsgsearchattribvalue cc = 7; const nsmsgsearchattribvalue toorcc = 8; const nsmsgsearchattribvalue alladdresses = 9; const nsmsgsearchattribvalue location = 10; /* result list only */ const nsmsgse...
nsMsgSearchOp
ba-aaaf-6c806c4ee420)] interface nsmsgsearchop { const nsmsgsearchopvalue contains = 0; /* for text attributes */ const nsmsgsearchopvalue doesntcontain = 1; const nsmsgsearchopvalue is = 2; /* is and isn't also apply to some non-text attrs */ const nsmsgsearchopvalue isnt = 3; const nsmsgsearchopvalue isempty = 4; const nsmsgsearchopvalue isbefore = 5; /* for date attributes */ const nsmsgsearchopvalue isafter = 6; const nsmsgsearchopvalue ishigherthan = 7; /* for priority.
nsMsgSearchTerm
%{c++ #define is_string_attribute(_a) \ (!(_a == nsmsgsearchattrib::priority || _a == nsmsgsearchattrib::date || \ _a == nsmsgsearchattrib::msgstatus || _a == nsmsgsearchattrib::messagekey || \ _a == nsmsgsearchattrib::size || _a == nsmsgsearchattrib::ageindays || \ _a == nsmsgsearchattrib::folderinfo || _a == nsmsgsearchattrib::location || \ _a == nsmsgsearchattrib::label || _a == nsmsgsearchattrib::junkstatus || \ _a == nsmsgsearchattrib::folderflag || _a == nsmsgsearchattrib::uint32hdrp...
nsMsgSearchValue
defined in comm-central/ mailnews/ base/ search/ public/ nsmsgsearchcore.idl use this to specify the value of a search term [ptr] native nsmsgsearchvalue(nsmsgsearchvalue); %{c++ typedef struct nsmsgsearchvalue { nsmsgsearchattribvalue attribute; union { nsmsgpriorityvalue priority; prtime date; pruint32 msgstatus; /* see msg_flag in msgcom.h */ pruint32 size; nsmsgkey key; print32 age; /* in days */ nsimsgfolder *folder; nsmsglabelvalue label; pruint32 junkstatus; pruint32 junkpercent; } u; char *string; } nsmsgsearchvalue; ...
nsMsgSearchWidgetValue
defined in comm-central/ mailnews/ base/ search/ public/ nsmsgsearchcore.idl fes use this to help build the search dialog box typedef long nsmsgsearchwidgetvalue; /* fes use this to help build the search dialog box */ [scriptable,uuid(903dd2e8-304e-11d3-92e6-00a0c900d445)] interface nsmsgsearchwidget { const nsmsgsearchwidgetvalue text = 0; const nsmsgsearchwidgetvalue date = 1; const nsmsgsearchwidgetvalue menu = 2; const nsmsgsearchwidgetvalue int = 3; /* added to account for age in days which requires an integer field */ const nsmsgsearchwidgetvalue none = 4; }; ...
nsIMsgSearchValue
attribute astring str; attribute nsmsgpriorityvalue priority; attribute prtime date; // see nsmsgmessageflags.idl and nsmsgfolderflags.idl attribute unsigned long status; attribute unsigned long size; attribute nsmsgkey msgkey; attribute long age; // in days attribute nsimsgfolder folder; attribute nsmsglabelvalue label; attribute nsmsgjunkstatus junkstatus; /* * junkpercent is set by the message filter plugin, and is approximately ...
nsMsgSearchOpValue
49 interface nsmsgsearchop { 150 const nsmsgsearchopvalue contains = 0; /* for text attributes */ 151 const nsmsgsearchopvalue doesntcontain = 1; 152 const nsmsgsearchopvalue is = 2; /* is and isn't also apply to some non-text attrs */ 153 const nsmsgsearchopvalue isnt = 3; 154 const nsmsgsearchopvalue isempty = 4; 155 156 const nsmsgsearchopvalue isbefore = 5; /* for date attributes */ 157 const nsmsgsearchopvalue isafter = 6; 158 159 const nsmsgsearchopvalue ishigherthan = 7; /* for priority.
nsMsgViewSortOrder
for example to sort by date you would pass a function the value: components.interfaces.nsmsgviewsortorder.ascending mailnews/base/public/nsimsgdbview.idlscriptable please add a summary to this article.
Performance
for example sqlite> explain query plan select * from moz_historyvisit v join moz_history h on v.page_id = h.id where v.visit_date > 1000000000; 0|0|table moz_historyvisit as v with index moz_historyvisit_dateindex 1|1|table moz_history as h using primary key this tells us that it will first look up in moz_historyvisit using an index, and will then look up in moz_history using the primary key.
Status, Recent Changes, and Plans
added an entire section to the getting started guide on nscomptrs in function signatures added references to recent bugs influencing the use of nscomptr machinery: bug 59212, and bug 59414 fixed comparisons 1 and 3, as per comments by morten welinder updated examples to prefer direct initialization over copy initialization.
Using nsCOMPtr
general bibliography original document information author(s): scott collins last updated date: december 11, 2001 copyright information: copyright © 1999, 2000 by the mozilla organization; use is subject to the mpl.
Using nsIClassInfo
original document information authors: mike shaver, justin lebar last updated date: july 25, 2011 copyright information: portions of this content are © 1998–2011 by individual mozilla.org contributors; content available under a creative commons license | details.
Using nsIDirectoryService
related pages code_snippets:file_i/o original document information authors: conrad carlen, doug turner last updated date: september 26, 2000 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Weak reference
see also the source xpcom/base/nsiweakreference.idl xpcom/glue/nsweakreference.h xpcom/glue/nsweakreference.cpp xpcom ownership guidelines using nscomptr original document information author: scott collins last updated date: september 23, 2000 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
XPCOM ownership guidelines
original document information author: scott collins last updated date: may 8, 2003 copyright information: copyright© 1999 by netscape; use is subject to the npl.
XPCOM
if the referent object is destroyed before the weak reference, the pointer inside the weak reference is set to nsnull.working with multiple versions of interfacesin this short note we illustrate how one can update an xpcom module in order for it to work in both firefox 2 and firefox 3, even if the interfaces have changed in the interim.working with out parameterswrappedjsobjectwrappedjsobject is a property sometimes available on xpconnect wrappers.
XTF
MozillaTechXTF
xtf home the xtf home (outdated).
XUL Overlays
MozillaTechXULOverlays
though overlays often define ui elements that have been added as a result of an update or enhancement of some kind, they can be used in many different ways.
Address Book examples
list object that implements nsiabdirectory: let abmanager = components.classes["@mozilla.org/abmanager;1"] .getservice(components.interfaces.nsiabmanager); let maillistdirectory = abmanager.getdirectory(maillistcard.maillisturi); you can then adjust the items in the actual mailing list: maillistdirectory.addresslists.appendelement(newcard, false); then save the updated list to the database: maillistdirectory.editmaillisttodatabase(maillistcard); deleting a mailing list there are two ways to delete a mailing list.
Autoconfiguration in Thunderbird
this method is not practical for other use cases, because it is difficult to update the configuration file.
Gloda examples
ation); query.subjectmatches("gloda makes searching easy"); query.getcollection(alistener) search messages by tags searches for all messages having any (or several) of all tags defined in tb let query = gloda.newquery(gloda.noun_message); let tagarray = mailservices.tags.getalltags({}); query.tags(...tagarray); let collection = query.getcollection(mylistener); search messages by daterange searches for all messages within a date range id_q=gloda.newquery(gloda.noun_message); // define a date range form yesterday to now id_q.daterange([new date() - 86400000, new date()]); var mylistener = { /* called when new items are returned by the database query or freshly indexed */ onitemsadded: function _onitemsadded(aitems, acollection) { }, /* called when items that a...
LDAP Support
workcountry countryname _aimscreenname nscpaimscreenname webpage1 workurl webpage2 homeurl birthyear birthyear custom1 custom1 custom2 custom2 custom3 custom3 custom4 custom4 notes notes notes description prefermailformat xmozillausehtmlmail lastmodifieddate modifytimestamp custom ldap attributes thunderbird supports custom ldap attributes for various address book attributes.
MailNews Filters
finally, add protocol-specific code to apply your filter action in the various applyfilterhit methods imap pop3 news and "after the fact" since seamonkey and thunderbird share the filter code, you will also need to update the seamonkey .dtd and .property files.
Thunderbird Configuration Files
warning: the content of this article may be out of date.
Adding items to the Folder Pane
each time the folder pane determines that it is necessary to invalidate all its data (because of too many changes, or more commonly because the folder pane's "mode" (aka view) has changed), a "rebuild" occurs.
Building a Thunderbird extension 3: install manifest
it must be updated each time you release a new version of your extension.
Standard OS Libraries
there are updates that happen to x11; at the time of this writing, the latest version is 4.4.0.
Streams - Plugins
the buffer passed to npp_write may accommodate more bytes than the maximum number returned from npp_writeready .
URLs - Plugins
wysiwyg placed before another url; displays a page that javascript has updated using document.write.
3D view - Firefox Developer Tools
if you do not see the 3d button in the page inspector, it is possible that your graphics driver needs to be updated.
DOM Inspector FAQ - Firefox Developer Tools
original document information author(s): christopher aillon last updated date: november 11, 2003 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
DOM Property Viewer - Firefox Developer Tools
refreshing the display if the dom changes you can hit the refresh button to update the display: filtering there is a search box within the toolbar: this filters the list to show only items which match the search term.
Debug worker threads - Firefox Developer Tools
you can set a breakpoint (or logpoint) on any active worker thread: when execution is paused in a worker thread, the context of the debugger is updated to show the correct breakpoints, call stack, etc., just as you'd expect.
Debugger.Object - Firefox Developer Tools
this method makes it easier to gradually adapt large code bases to this debugger api: adapted portions of the code can use debugger.object instances, but use this method to pass direct object references to code that has not yet been updated.
Debugger - Firefox Developer Tools
in some cases, the code coverage might expose information which pre-date the modification of this flag.
Debugger.Object - Firefox Developer Tools
this method makes it easier to gradually adapt large code bases to this debugger api: adapted portions of the code can use debugger.object instances, but use this method to pass direct object references to code that has not yet been updated.
Index - Firefox Developer Tools
143 validators tools, website validator, html5 validator, validator this document lists different resources for developers to validate web pages.
Inspecting web sockets - Firefox Developer Tools
the live-updated table shows data for sent (green arrow) and received (red arrow) frames.
Edit CSS filters - Firefox Developer Tools
once you have added an effect, enter the settings you want and then press enter to update the effect.
Edit Shape Paths in CSS - Firefox Developer Tools
each side of the rectangle can be targeted after clicking on the shapes icon to activate the shape path editor, and dragging each side will update the values for the top, right, bottom, and left offset values.
UI Tour - Firefox Developer Tools
as new browser versions are released, the version numbers in this list will be updated.
Paint Flashing Tool - Firefox Developer Tools
the browser also splits its model of the page into layers that it expects will be updated independently of each other.
Call Tree - Firefox Developer Tools
functions with a relatively high self cost are good candidates for optimization, either because they take a long time to run, or because they are called very often.
UI Tour - Firefox Developer Tools
select a slice, and the main view will be updated to contain just the part selected.
Performance - Firefox Developer Tools
scenarios animating css properties uses the waterfall to understand how the browser updates a page, and how animating different css properties can affect performance.
Tips - Firefox Developer Tools
if no filename is included, the file name will be in this format: screen shot date at time.png the --fullpage parameter is optional.
Web Audio Editor - Firefox Developer Tools
however, the value isn't updated in real time: you have to click the node again to see the updated value.
ANGLE_instanced_arrays.vertexAttribDivisorANGLE() - Web APIs
divisor a gluint specifying the number of instances that will pass between updates of the generic attribute.
AddressErrors.addressLine - Web APIs
candidate recommendation initial definition.
AddressErrors.country - Web APIs
candidate recommendation initial definition.
Ambient Light Events - Web APIs
candidate recommendation initial definition ...
Ambient Light Sensor API - Web APIs
specifications specification status comment ambient light sensor candidate recommendation initial definition.
Animation - Web APIs
WebAPIAnimation
animation.updateplaybackrate() sets the speed of an animation after first synchronizing its playback position.
AnimationEffect - Web APIs
animationeffect.updatetiming() updates the specified timing properties of this animationeffect.
ArrayBufferView - Web APIs
candidate recommendation initial definition.
AudioContext.resume() - Web APIs
in each case, the text label of the button is updated as appropriate once the promise resolves.
AudioContext.suspend() - Web APIs
in each case, the text label of the button is updated as appropriate once the promise resolves.
AudioListener.dopplerFactor - Web APIs
generally you will define the position in 3d space that your audio listener and panner (source) occupy initially, and then update the position of one or both of these as the application is used.
AudioListener.forwardX - Web APIs
generally you will define the position in 3d space that your audio listener and panner (source) occupy initially, and then update the position of one or both of these as the application is used.
AudioListener.forwardY - Web APIs
generally you will define the position in 3d space that your audio listener and panner (source) occupy initially, and then update the position of one or both of these as the application is used.
AudioListener.forwardZ - Web APIs
generally you will define the position in 3d space that your audio listener and panner (source) occupy initially, and then update the position of one or both of these as the application is used.
AudioListener.positionX - Web APIs
generally you will define the position in 3d space that your audio listener and panner (source) occupy initially, and then update the position of one or both of these as the application is used.
AudioListener.positionY - Web APIs
generally you will define the position in 3d space that your audio listener and panner (source) occupy initially, and then update the position of one or both of these as the application is used.
AudioListener.positionZ - Web APIs
generally you will define the position in 3d space that your audio listener and panner (source) occupy initially, and then update the position of one or both of these as the application is used.
AudioListener.setOrientation() - Web APIs
generally you will define the position in 3d space that your audio listener and panner (source) occupy initially, and then update the position of one or both of these as the application is used.
AudioListener.setPosition() - Web APIs
generally you will define the position in 3d space that your audio listener and panner (source) occupy initially, and then update the position of one or both of these as the application is used.
AudioListener.speedOfSound - Web APIs
generally you will define the position in 3d space that your audio listener and panner (source) occupy initially, and then update the position of one or both of these as the application is used.
AudioListener.upX - Web APIs
WebAPIAudioListenerupX
generally you will define the position in 3d space that your audio listener and panner (source) occupy initially, and then update the position of one or both of these as the application is used.
AudioListener.upY - Web APIs
WebAPIAudioListenerupY
generally you will define the position in 3d space that your audio listener and panner (source) occupy initially, and then update the position of one or both of these as the application is used.
AudioListener.upZ - Web APIs
WebAPIAudioListenerupZ
generally you will define the position in 3d space that your audio listener and panner (source) occupy initially, and then update the position of one or both of these as the application is used.
AudioListener - Web APIs
generally you will define the position in 3d space that your audio listener and panner (source) occupy initially, and then update the position of one or both of these as the application is used.
AuthenticatorAssertionResponse.authenticatorData - Web APIs
the bits are as follows, where "bit 0" is the least significant bit and all bits not specifically mentioned below are "reserved for future use": bit 0, user presence (up) - if set, authenticator validated that the user was present through some test of user presence (tup), such as touching a button on the authenticator.
BaseAudioContext.createPanner() - Web APIs
generally you will define the position in 3d space that your audio listener and panner (source) occupy initially, and then update the position of one or both of these as the application is used.
BaseAudioContext.createStereoPanner() - Web APIs
we then use an oninput event handler to change the value of the stereopannernode.pan parameter and update the pan value display when the slider is moved.
BasicCardResponse - Web APIs
the basiccardresponse dictionary (related to the payment request api, although defined in the basic card payment spec) defines an object structure for payment response details such as the number/expiry date of the card used to make the payment, and the billing address.
BatteryManager.charging - Web APIs
example html content <div id="charging">(charging state unknown)</div> javascript content navigator.getbattery().then(function(battery) { var charging = battery.charging; document.queryselector('#charging').textcontent = charging ; }); specifications specification status comment battery status api candidate recommendation initial definition ...
BatteryManager.chargingTime - Web APIs
example html content <div id="chargingtime">(charging time unknown)</div> javascript content navigator.getbattery().then(function(battery) { var time = battery.chargingtime; document.queryselector('#chargingtime').textcontent = battery.chargingtime; }); specifications specification status comment battery status api candidate recommendation initial definition ...
BatteryManager.dischargingTime - Web APIs
example html content <div id="dischargingtime">(discharging time unknown)</div> javascript content navigator.getbattery().then(function(battery) { var time = battery.dischargingtime; document.queryselector('#dischargingtime').textcontent = battery.dischargingtime; }); specifications specification status comment battery status api candidate recommendation initial definition ...
BatteryManager.level - Web APIs
example html content <div id="level">(battery level unknown)</div> javascript content navigator.getbattery().then(function(battery) { var level = battery.level; document.queryselector('#level').textcontent = level; }); specifications specification status comment battery status api candidate recommendation initial definition ...
Using the Beacon API - Web APIs
window.onsubmit = function send_analytics() { var data = json.stringify({ location: location.href, time: date() }); navigator.sendbeacon('/analytics', data); }; workernavigator.sendbeacon() the beacon api's workernavigator.sendbeacon() method works identically to the usual method, but is accessible from worker global scope.
BluetoothRemoteGATTCharacteristic.value - Web APIs
this value gets updated when the value of the characteristic is read or updated via a notification or indication.
BluetoothRemoteGATTCharacteristic - Web APIs
this value gets updated when the value of the characteristic is read or updated via a notification or indication.
value - Web APIs
this value gets updated when the value of the descriptor is read.
BluetoothRemoteGATTDescriptor - Web APIs
this value gets updated when the value of the descriptor is read.
BufferSource - Web APIs
candidate recommendation initial definition.
ByteString - Web APIs
candidate recommendation initial definition.
CSS.supports() - Web APIs
WebAPICSSsupports
candidate recommendation initial definition.
CSS - Web APIs
WebAPICSS
candidate recommendation initial definition ...
CSSConditionRule - Web APIs
candidate recommendation initial definition.
CSSCounterStyleRule - Web APIs
candidate recommendation initial definition.
CSSMediaRule - Web APIs
candidate recommendation make it derived from the cssconditionrule.
CSSStyleDeclaration.setProperty() - Web APIs
we then use three functions to generate random values for the properties in question, and update the rule with these values.
CSSStyleSheet.cssRules - Web APIs
the read-only cssstylesheet property cssrules returns a live cssrulelist which provides a real-time, up-to-date list of every css rule which comprises the stylesheet.
CSSSupportsRule - Web APIs
candidate recommendation initial definition ...
CSS Counter Styles - Web APIs
specifications specification status comment css counter styles level 3 candidate recommendation initial definition ...
Cache.delete() - Web APIs
WebAPICachedelete
examples caches.open('v1').then(function(cache) { cache.delete('/images/image.png').then(function(response) { someuiupdatefunction(); }); }) specifications specification status comment service workersthe definition of 'cache: delete' in that specification.
CanvasCaptureMediaStreamTrack.requestFrame() - Web APIs
this may change in the future, so it would be wise to plan ahead and watch for exceptions such as securityerror (although the specific error that might be thrown is not mentioned in the spec, this is a likely candidate).
CanvasPattern.setTransform() - Web APIs
); pattern.settransform(matrix.rotate(-45).scale(1.5)); ctx.fillstyle = pattern; ctx.fillrect(0, 0, 400, 400); }; note that newer browser versions started to support dommatrix as an input to settransform(), so for example you could replace the svgmatrix in the above example with the following: const matrix = new dommatrix([1, .2, .8, 1, 0, 0]); edit the code below and see your changes update live in the canvas: playable code <canvas id="canvas" width="400" height="200" class="playable-canvas"></canvas> <svg id="svg1" style="display:none"></svg> <div class="playable-buttons"> <input id="edit" type="button" value="edit" /> <input id="reset" type="button" value="reset" /> </div> <textarea id="code" class="playable-code" style="height:120px"> var img = new image(); img.src = 'http...
CanvasRenderingContext2D.addHitRegion() - Web APIs
ion) { alert('ouch, my eye :('); } }); ctx.beginpath(); ctx.arc(100, 100, 75, 0, 2 * math.pi); ctx.linewidth = 5; ctx.stroke(); // eyes ctx.beginpath(); ctx.arc(70, 80, 10, 0, 2 * math.pi); ctx.arc(130, 80, 10, 0, 2 * math.pi); ctx.fill(); ctx.addhitregion({id: "eyes"}); // mouth ctx.beginpath(); ctx.arc(100, 110, 50, 0, math.pi); ctx.stroke(); edit the code below to see your changes update live in the canvas.
CanvasRenderingContext2D.globalCompositeOperation - Web APIs
living standard compositing and blending level 1 candidate recommendation ...
CanvasRenderingContext2D.scrollPathIntoView() - Web APIs
html <canvas id="canvas"></canvas> javascript const canvas = document.getelementbyid('canvas'); const ctx = canvas.getcontext('2d'); ctx.beginpath(); ctx.fillrect(10, 10, 30, 30); ctx.scrollpathintoview(); edit the code below to see your changes update live in the canvas: playable code <canvas id="canvas" width="400" height="200" class="playable-canvas"> <input id="button" type="range" min="1" max="12"> </canvas> <div class="playable-buttons"> <input id="edit" type="button" value="edit" /> <input id="reset" type="button" value="reset" /> </div> <textarea id="code" class="playable-code"> ctx.beginpath(); ctx.rect(10, 10, 30, 30); ctx.scro...
Drawing shapes with canvas - Web APIs
with the new path2d api, several methods got updated to optionally accept a path2d object to use instead of the current path.
Drawing text - Web APIs
a textbaseline example edit the code below and see your changes update live in the canvas: ctx.font = '48px serif'; ctx.textbaseline = 'hanging'; ctx.stroketext('hello world', 0, 100); playable code <canvas id="canvas" width="400" height="200" class="playable-canvas"></canvas> <div class="playable-buttons"> <input id="edit" type="button" value="edit" /> <input id="reset" type="button" value="reset" /> </div> <textarea id="code" class="playable-code"> ctx.fo...
Clipboard.writeText() - Web APIs
return value a promise which is resolved once the clipboard's contents have been updated.
CompositionEvent.data - Web APIs
for compositionupdate, this is the string as it stands currently as editing is ongoing.
CompositionEvent.initCompositionEvent() - Web APIs
syntax compositioneventinstance.initcompositionevent(typearg, canbubblearg, cancelablearg, viewarg, dataarg, localearg) parameters typearg a domstring representing the type of composition event; this will be one of compositionstart, compositionupdate, or compositionend.
console.log() - Web APIs
WebAPIConsolelog
otherwise, many browsers provide a live view that constantly updates as values change.
ConstrainBoolean - Web APIs
candidate recommendation initial definition technically, constrainboolean is actually based on an intermediary dictionary named constrainbooleanparameters, which adds exact and ideal to the simple boolean type.
ConstrainDOMString - Web APIs
candidate recommendation initial definition technically, constraindomstring is actually based on an intermediary dictionary named constraindomstringparameters, which adds exact and ideal to domstring.
ConstrainDouble - Web APIs
candidate recommendation initial definition technically, constraindouble is actually based on an intermediary dictionary named constraindoublerange, which adds exact and ideal to doublerange, with constraindouble being a type that can be either a long integer or a doublerange.
ConstrainULong - Web APIs
candidate recommendation initial definition technically, constrainulong is actually based on an intermediary dictionary named constrainulongrange, which adds exact and ideal to ulongrange, with constrainulong being a type that can be either a long integer or a ulongrange.
Crypto.getRandomValues() - Web APIs
there is no minimum degree of entropy mandated by the web cryptography specification.
CustomElementRegistry.define() - Web APIs
node.textcontent return text.split(/\s+/g).length; } var count = 'words: ' + countwords(wcparent); // create a shadow root var shadow = this.attachshadow({mode: 'open'}); // create text node and add word count to it var text = document.createelement('span'); text.textcontent = count; // append it to the shadow root shadow.appendchild(text); // update count when element content changes setinterval(function() { var count = 'words: ' + countwords(wcparent); text.textcontent = count; }, 200) } } // define the new element customelements.define('word-count', wordcount, { extends: 'p' }); <p is="word-count"></p> specifications specification status comment html living standardthe definition of 'custo...
CustomElementRegistry - Web APIs
node.textcontent return text.split(/\s+/g).length; } var count = 'words: ' + countwords(wcparent); // create a shadow root var shadow = this.attachshadow({mode: 'open'}); // create text node and add word count to it var text = document.createelement('span'); text.textcontent = count; // append it to the shadow root shadow.appendchild(text); // update count when element content changes setinterval(function() { var count = 'words: ' + countwords(wcparent); text.textcontent = count; }, 200) } } // define the new element customelements.define('word-count', wordcount, { extends: 'p' }); note: the customelementregistry is available through the window.customelements property.
DOMConfiguration - Web APIs
pre-defined parameters: "canonical-form", "cdata-sections", "check-character-normalization", "comments", "datatype-normalization", "element-content-whitespace", "entities", "error-handler", "infoset", "namespaces", "namespace-declarations", "normalize-characters","schema-location", "schema-type", "split-cdata-sections", "validate", "validate-if-schema", "well-formed" properties domconfiguration.parameternames read only is a domstringlist methods domconfiguration.cansetparameter() returns a boolean domconfiguration.getparameter() returns a domuserdata domconfiguration.setparameter() sets a parameter specification http://www.w3.org/tr/dom-level-3-cor...mconfiguration ...
DOMException() - Web APIs
candidate recommendation adds the constructor for the domexception class.
DOMException.code - Web APIs
WebAPIDOMExceptioncode
candidate recommendation browser compatibility the compatibility table on this page is generated from structured data.
DOMException.message - Web APIs
candidate recommendation browser compatibility the compatibility table on this page is generated from structured data.
DOMException.name - Web APIs
WebAPIDOMExceptionname
candidate recommendation ...
DOMException - Web APIs
candidate recommendation adds the constructor for the domexception class.
DOMMatrix() - Web APIs
candidate recommendation initial definition.
DOMMatrix - Web APIs
WebAPIDOMMatrix
candidate recommendation initial definition ...
DOMMatrixReadOnly() - Web APIs
candidate recommendation initial definition.
DOMMatrixReadOnly.flipX() - Web APIs
candidate recommendation initial definition ...
DOMMatrixReadOnly.scale() - Web APIs
candidate recommendation initial definition ...
DOMMatrixReadOnly.translate() - Web APIs
candidate recommendation initial definition ...
DOMMatrixReadOnly - Web APIs
candidate recommendation initial definition ...
DOMPoint.fromPoint() - Web APIs
candidate recommendation initial definition ...
DOMPoint.DOMPoint() - Web APIs
WebAPIDOMPointDOMPoint
candidate recommendation initial definition ...
DOMPoint.w - Web APIs
WebAPIDOMPointw
candidate recommendation initial definition ...
DOMPoint.x - Web APIs
WebAPIDOMPointx
candidate recommendation initial definition ...
DOMPoint.y - Web APIs
WebAPIDOMPointy
candidate recommendation initial definition ...
DOMPoint.z - Web APIs
WebAPIDOMPointz
candidate recommendation initial definition ...
DOMPoint - Web APIs
WebAPIDOMPoint
candidate recommendation ...
DOMPointInit.w - Web APIs
WebAPIDOMPointInitw
candidate recommendation initial definition ...
DOMPointInit.x - Web APIs
WebAPIDOMPointInitx
candidate recommendation initial definition ...
DOMPointInit.y - Web APIs
WebAPIDOMPointInity
candidate recommendation initial definition ...
DOMPointInit.z - Web APIs
WebAPIDOMPointInitz
candidate recommendation initial definition ...
DOMPointInit - Web APIs
candidate recommendation initial definition ...
DOMPointReadOnly() - Web APIs
candidate recommendation initial definition ...
DOMPointReadOnly.fromPoint() - Web APIs
candidate recommendation initial definition ...
DOMPointReadOnly.toJSON() - Web APIs
candidate recommendation initial definition ...
DOMPointReadOnly.w - Web APIs
candidate recommendation initial definition ...
DOMPointReadOnly.x - Web APIs
candidate recommendation initial definition ...
DOMPointReadOnly.y - Web APIs
candidate recommendation initial definition ...
DOMPointReadOnly.z - Web APIs
candidate recommendation initial definition ...
DOMPointReadOnly - Web APIs
candidate recommendation latest spec version is an ed.
DOMQuad - Web APIs
WebAPIDOMQuad
candidate recommendation initial definition.
DOMRect.DOMRect() - Web APIs
WebAPIDOMRectDOMRect
candidate recommendation initial definition.
DOMRect - Web APIs
WebAPIDOMRect
candidate recommendation initial definition.
DOMRectReadOnly() - Web APIs
candidate recommendation initial definition.
DOMRectReadOnly.bottom - Web APIs
candidate recommendation latest spec version is an ed.
DOMRectReadOnly.fromRect() - Web APIs
candidate recommendation initial definition.
DOMRectReadOnly.height - Web APIs
candidate recommendation latest spec version is an ed.
DOMRectReadOnly.left - Web APIs
candidate recommendation latest spec version is an ed.
DOMRectReadOnly.right - Web APIs
candidate recommendation latest spec version is an ed.
DOMRectReadOnly.top - Web APIs
candidate recommendation latest spec version is an ed.
DOMRectReadOnly.width - Web APIs
candidate recommendation latest spec version is an ed.
DOMRectReadOnly.x - Web APIs
WebAPIDOMRectReadOnlyx
candidate recommendation latest spec version is an ed.
DOMRectReadOnly.y - Web APIs
WebAPIDOMRectReadOnlyy
candidate recommendation latest spec version is an ed.
DOMRectReadOnly - Web APIs
candidate recommendation initial definition.
DOMString - Web APIs
WebAPIDOMString
candidate recommendation ...
DOMTimeStamp - Web APIs
candidate recommendation initial specification ...
DOMTokenList - Web APIs
examples in the following simple example, we retrieve the list of classes set on a <p> element as a domtokenlist using element.classlist, add a class using domtokenlist.add(), and then update the node.textcontent of the <p> to equal the domtokenlist.
Detecting device orientation - Web APIs
window.addeventlistener("deviceorientation", handleorientation, true); after registering your event listener (in this case, a javascript function called handleorientation()), your listener function periodically gets called with updated orientation data.
Using light sensors - Web APIs
candidate recommendation initial specification ...
DeviceLightEvent.value - Web APIs
candidate recommendation initial definition ...
DirectoryEntrySync - Web APIs
about this document this document was last updated on march 2, 2012 and follows the w3c specifications (working draft) drafted on april 19, 2011.
DirectoryReaderSync - Web APIs
about this document this document was last updated on march 2, 2012 and follows the w3c specifications (working draft) drafted on april 19, 2011.
Document.createProcessingInstruction() - Web APIs
obsolete added more explicit definition of how the data parameter is validated.
Document.exitPointerLock() - Web APIs
candidate recommendation extend the document interface ...
Document.getElementsByName() - Web APIs
syntax var elements = document.getelementsbyname(name); elements is a live nodelist collection, meaning it automatically updates as new elements with the same name are added to/removed from the document.
Document.getElementsByTagName() - Web APIs
the returned htmlcollection is live, meaning that it updates itself automatically to stay in sync with the dom tree without having to call document.getelementsbytagname() again.
Document.getElementsByTagNameNS() - Web APIs
(to accommodate explorer, one could call an xpath wrapper instead of the xpath in the function below (as explorer supports xpath with a different api), such as this wrapper class.) function getelementsbytagnamenswrapper (ns, elname, doc, context) { if (!doc) { doc = document; } if (!context) { context = doc; } var result = doc.evaluate('//*[local-name()="'+elname+'" and namespace-uri() = "'+ns+'"]', c...
Document: pointerlockchange event - Web APIs
rty onpointerlockchange examples using addeventlistener(): document.addeventlistener('pointerlockchange', (event) => { console.log('pointer lock changed'); }); using the onpointerlockchange event handler property: document.onpointerlockchange = (event) => { console.log('pointer lock changed'); }; specifications specification status pointer lock candidate recommendation ...
Document: pointerlockerror event - Web APIs
using addeventlistener(): const para = document.queryselector('p'); document.addeventlistener('pointerlockerror', (event) => { console.log('error locking pointer'); }); using the onpointerlockerror event handler property: document.onpointerlockerror = (event) => { console.log('error locking pointer'); }; specifications specification status pointer lock candidate recommendation ...
Document.requestStorageAccess() - Web APIs
the ephemeral storage access grant is: invalidated at the end of the browser session.
Document.rootElement - Web APIs
candidate recommendation deprecated scalable vector graphics (svg) 1.1 (second edition)the definition of 'svgdocument.rootelement' in that specification.
Document: visibilitychange event - Web APIs
bubbles yes cancelable no interface event event handler property onvisibilitychange usage notes the event doesn't include the document's updated visibility status, but you can get that information from the document's visibilitystate property.
DocumentOrShadowRoot.pointerLockElement - Web APIs
candidate recommendation extend the document interface ...
Examples of web and XML development using the DOM - Web APIs
but the stopevent method has stopped propagation, and so after the data in the table is updated, the event phase is effectively ended, and an alert box is displayed to confirm this.
DoubleRange - Web APIs
candidate recommendation initial definition ...
EffectTiming.fill - Web APIs
WebAPIEffectTimingfill
elem.addeventlistener('click', async evt => { const animation = elem.animate( { transform: `translate(${evt.clientx}px, ${evt.clienty}px)` }, { duration: 800, fill: 'forwards' } ); await animation.finished; // commitstyles will record the style up to and including `animation` and // update elem’s specified style with the result.
Element.attachShadow() - Web APIs
extcontent return text.trim().split(/\s+/g).length; } var count = 'words: ' + countwords(wcparent); // create a shadow root var shadow = this.attachshadow({mode: 'open'}); // create text node and add word count to it var text = document.createelement('span'); text.textcontent = count; // append it to the shadow root shadow.appendchild(text); // update count when element content changes setinterval(function() { var count = 'words: ' + countwords(wcparent); text.textcontent = count; }, 200) } } // define the new element customelements.define('word-count', wordcount, { extends: 'p' }); specifications specification status comment domthe definition of 'attachshadow()' in that specification.
Element: compositionend event - Web APIs
t log = document.queryselector('.event-log-contents'); const clearlog = document.queryselector('.clear-log'); clearlog.addeventlistener('click', () => { log.textcontent = ''; }); function handleevent(event) { log.textcontent = log.textcontent + `${event.type}: ${event.data}\n`; } inputelement.addeventlistener('compositionstart', handleevent); inputelement.addeventlistener('compositionupdate', handleevent); inputelement.addeventlistener('compositionend', handleevent); result specifications specification status ui events working draft ...
Element: compositionstart event - Web APIs
t log = document.queryselector('.event-log-contents'); const clearlog = document.queryselector('.clear-log'); clearlog.addeventlistener('click', () => { log.textcontent = ''; }); function handleevent(event) { log.textcontent = log.textcontent + `${event.type}: ${event.data}\n`; } inputelement.addeventlistener('compositionstart', handleevent); inputelement.addeventlistener('compositionupdate', handleevent); inputelement.addeventlistener('compositionend', handleevent); result specifications specification status ui events working draft ...
Element.computedStyleMap() - Web APIs
update the 'a' to the 'p', and you'll notice a difference in the margin-top and margin-bottom default computed values.
Element: cut event - Web APIs
WebAPIElementcut event
note though that cancelling the default action will also prevent the document from being updated.
Element.getElementsByTagName() - Web APIs
the returned list is live, which means it updates itself with the dom tree automatically.
Element.innerHTML - Web APIs
WebAPIElementinnerHTML
javascript function log(msg) { var logelem = document.queryselector(".log"); var time = new date(); var timestr = time.tolocaletimestring(); logelem.innerhtml += timestr + ": " + msg + "<br/>"; } log("logging mouse events inside this container..."); the log() function creates the log output by getting the current time from a date object using tolocaletimestring(), and building a string with the timestamp and the message text.
Element: mousewheel event - Web APIs
the obsolete and non-standard mousewheel event is fired asynchronously at an element to provide updates while a mouse wheel or similar device is operated.
Element.requestPointerLock() - Web APIs
candidate recommendation ...
Element.setAttribute() - Web APIs
if the attribute already exists, the value is updated; otherwise a new attribute is added with the specified name and value.
Event - Web APIs
WebAPIEvent
celightevent devicemotionevent deviceorientationevent deviceproximityevent domtransactionevent dragevent editingbeforeinputevent errorevent fetchevent focusevent gamepadevent hashchangeevent idbversionchangeevent inputevent keyboardevent mediastreamevent messageevent mouseevent mutationevent offlineaudiocompletionevent overconstrainederror pagetransitionevent paymentrequestupdateevent pointerevent popstateevent progressevent relatedevent rtcdatachannelevent rtcidentityerrorevent rtcidentityevent rtcpeerconnectioniceevent sensorevent storageevent svgevent svgzoomevent timeevent touchevent trackevent transitionevent uievent userproximityevent webglcontextevent wheelevent constructor event() creates an event object, returning it to the caller.
EventTarget.addEventListener() - Web APIs
this, and the fact that objects can have properties, and that they can be passed around by reference, makes them likely candidates for sharing data among scopes.
ExtendableEvent.waitUntil() - Web APIs
this gives the service worker time to update database schemas and delete outdated caches, so other events can rely on a completely upgraded state.
ExtendableEvent - Web APIs
this ensures that any functional events (like fetchevent) are not dispatched until it upgrades database schemas and deletes the outdated cache entries.
Fetch API - Web APIs
WebAPIFetch API
the following browsers shipped and outdated native fetch, and were updated in these versions: firefox version 61.0b13.
File.File() - Web APIs
WebAPIFileFile
defaults to a value of date.now().
File - Web APIs
WebAPIFile
file.prototype.lastmodifieddate read only returns the last modified date of the file referenced by the file object.
FileEntrySync - Web APIs
inherits from: entrysync about this document this document was last updated on march 2, 2012 and follows the w3c specifications (working draft) drafted on april 19, 2011.
FileSystemEntry.getMetadata() - Web APIs
} the filesystementry interface's method getmetadata() obtains a metadata object with information about the file system entry, such as its modification date and time and its size.
FileSystemEntry.getParent() - Web APIs
fileentry.getparent(function(parent) { fileentry.moveto(parent, "newname.html", function(updatedentry) { console.log("file " + fileentry.name + " renamed to newname.html."); }); }, function(error) { console.error("an error occurred: unable to rename " + fileentry.name + " to newname.html."); }); this is accomplished by first obtaining a filesystemdirectoryentry object representing the directory the file is currently located in.
FileSystemEntry - Web APIs
getmetadata() obtains metadata about the file, such as its modification date and size.
FileSystemSync - Web APIs
about this document this document was last updated on march 2, 2012 and follows the w3c specifications (working draft) drafted on april 19, 2011.
FileHandle API - Web APIs
this information (as well as the date of its last modification) can be retrieved through the lockedfile.getmetadata() method.
File and Directory Entries API support in Firefox - Web APIs
hopefully chrome will be updated soon to use the newer names!
Gamepad - Web APIs
WebAPIGamepad
gamepad.timestamp read only a domhighrestimestamp representing the last time the data for this gamepad was updated.
GeolocationPosition.timestamp - Web APIs
the geolocationposition.timestamp read-only property returns a domtimestamp object, represents the date and the time of the creation of the geolocationposition object it belongs to.
Geolocation API - Web APIs
geolocation.watchposition(): registers a handler function that will be called automatically each time the position of the device changes, returning the updated location.
GlobalEventHandlers.onanimationiteration - Web APIs
it simply sets the box's animation-play-state to "paused", then updates the text displayed in the button to indicate that clicking the button will start playing the next iteration of theanimation.
GlobalEventHandlers.onauxclick - Web APIs
specifically, event behavior is being updated so that click only fires for primary button clicks (e.g., left mouse button), while auxclick fires for non-primary button clicks.
GlobalEventHandlers.ondurationchange - Web APIs
the durationchange event is fired when the duration attribute has been updated.
GlobalEventHandlers.ontransitioncancel - Web APIs
example in this example, we use the transitionrun and transitionend events to detect when the transition begins and ends, to cause a text update to occur during the transition.
GlobalEventHandlers.ontransitionend - Web APIs
example in this example, we use the transitionrun and transitionend events to detect when the transition begins and ends, to cause a text update to occur during the transition.
HTMLAnchorElement.referrerPolicy - Web APIs
candidate recommendation added the referrerpolicy property.
HTMLAreaElement.referrerPolicy - Web APIs
candidate recommendation added the referrerpolicy property.
HTMLCollection - Web APIs
an htmlcollection in the html dom is live; it is automatically updated when the underlying document is changed.
HTMLDetailsElement - Web APIs
candidate recommendation ...
HTMLElement.dir - Web APIs
WebAPIHTMLElementdir
firefox uses ctrl/cmd + shift + x but does not update the dir attribute value.
HTMLElement: input event - Web APIs
html <input placeholder="enter some text" name="name"/> <p id="values"></p> javascript const input = document.queryselector('input'); const log = document.getelementbyid('values'); input.addeventlistener('input', updatevalue); function updatevalue(e) { log.textcontent = e.target.value; } result specifications specification status html living standardthe definition of 'input event' in that specification.
HTMLFormElement.requestSubmit() - Web APIs
the form's content is validated, and the form is submitted only if validation succeeds.
HTMLHyperlinkElementUtils.href - Web APIs
the htmlhyperlinkelementutils.href property is a stringifier that returns a usvstring containing the whole url, and allows the href to be updated.
HTMLHyperlinkElementUtils - Web APIs
htmlhyperlinkelementutils.href this a stringifier property that returns a usvstring containing the whole url, and allows the href to be updated.
HTMLIFrameElement.allowPaymentRequest - Web APIs
candidate recommendation adds allowpaymentrequest property.
HTMLIFrameElement.referrerPolicy - Web APIs
candidate recommendation added the referrerpolicy attribute.
HTMLImageElement.alt - Web APIs
for example, if an image is a badge that's shown on a page to indicate that the content of the page is new and has been updated recently, the corresponding alt text might be "updated recently" or even "updated on 27 august 2019".
HTMLImageElement.loading - Web APIs
preventing element shift during image lazy loads when an image whose loading has been delayed by the loading attribute being set to lazy is finally loaded, the browser will determine the final size of the <img> element based on the style and intrinsic size of the image, then reflow the document as needed to update the positions of elements based on any size change made to the element to fit the image.
HTMLImageElement.referrerPolicy - Web APIs
candidate recommendation added the referrerpolicy property.
HTMLInputElement.setRangeText() - Web APIs
html <input type="text" id="text-box" size="30" value="this text has not been updated."> <button onclick="selecttext()">update text</button> javascript function selecttext() { const input = document.getelementbyid('text-box'); input.focus(); input.setrangetext('already', 14, 17, 'select'); } result specifications specification status comment html living standardthe definition of 'htmlinputelement.setselectionrange()' in that specification...
HTMLInputElement.setSelectionRange() - Web APIs
this method updates the htmlinputelement.selectionstart, selectionend, and selectiondirection properties in one call.
HTMLLinkElement.as - Web APIs
candidate recommendation initial definition.
HTMLLinkElement.referrerPolicy - Web APIs
candidate recommendation ...
HTMLLinkElement - Web APIs
specifications specification status comment preload candidate recommendation defines <link rel="preload">, and the as property.
HTMLMediaElement.disableRemotePlayback - Web APIs
candidate recommendation initial definition.
HTMLMediaElement: durationchange event - Web APIs
the durationchange event is fired when the duration attribute has been updated.
HTMLMediaElement.load() - Web APIs
if resetting the playback position to the beginning of the media actually changes the playback position (that is, it was not already at the beginning), a timeupdate event is sent.
HTMLMediaElement.play() - Web APIs
for example, a site should not present a user interface that assumes playback has begun automatically, but should instead update their ui based on whether the returned promise is resolved or rejected.
HTMLMediaElement.setSinkId() - Web APIs
candidate recommendation initial definition.
HTMLMediaElement.sinkId - Web APIs
candidate recommendation initial definition.
HTMLModElement - Web APIs
htmlmodelement.datetime is a domstring reflecting the datetime html attribute, containing a date-and-time string representing a timestamp for the change.
HTMLObjectElement.checkValidity - Web APIs
the checkvalidity() method of the htmlobjectelement interface returns a boolean that always is true, because object objects are never candidates for constraint validation.
HTMLObjectElement.setCustomValidity - Web APIs
function validate(inputid) { var input = document.getelementbyid(inputid); var validitystate_object = input.validity; if (validitystate_object.valuemissing) { input.setcustomvalidity('you gotta fill this out, yo!'); input.reportvalidity(); } else if (input.rangeunderflow) { input.setcustomvalidity('we need a higher number!'); input.reportvalidity(); } else if (input.rangeoverflow) { input.setc...
HTMLObjectElement.validationMessage - Web APIs
this is the empty string if the control is not a candidate for constraint validation (willvalidate is false), or it satisfies its constraints.
HTMLOrForeignElement.dataset - Web APIs
examples <div id="user" data-id="1234567890" data-user="johndoe" data-date-of-birth>john doe</div> const el = document.queryselector('#user'); // el.id === 'user' // el.dataset.id === '1234567890' // el.dataset.user === 'johndoe' // el.dataset.dateofbirth === '' // set the data attribute el.dataset.dateofbirth = '1960-10-03'; // result: el.dataset.dateofbirth === 1960-10-03 delete el.dataset.dateofbirth; // result: el.dataset.dateofbirth === undefined // 'somedataa...
HTMLElement.focus() - Web APIs
obsolete notes if you call htmlelement.focus() from a mousedown event handler, you must call event.preventdefault() to keep the focus from leaving the htmlelement behaviour of the focus in relation to different html features like tabindex or shadow dom, which previously remained under-specified, were recently updated (as october of 2019).
HTMLScriptElement.referrerPolicy - Web APIs
candidate recommendation added the referrerpolicy attribute.
HTMLTableRowElement - Web APIs
the htmlcollection is live and is automatically updated when cells are added or removed.
HTMLTableSectionElement - Web APIs
the htmlcollection is live and is automatically updated when rows are added or removed.
HTMLTimeElement - Web APIs
htmltimeelement.datetime is a domstring that reflects the datetime html attribute, containing a machine-readable form of the element's date and time value.
HTMLVideoElement.getVideoPlaybackQuality() - Web APIs
example this example updates an element to indicate the total number of video frames that have elapsed so far in the playback process.
Recommended Drag Types - Web APIs
updates to datatransfer.types the latest spec dictates that datatransfer.types should return a frozen array of domstrings rather than a domstringlist (this is supported in firefox 52 and above).
Headers.get() - Web APIs
WebAPIHeadersget
the latest spec has removed getall(), and updated get() to return all values.
Headers.getAll() - Web APIs
WebAPIHeadersgetAll
the getall() method of the headers interface used to return an array of all the values of a header within a headers object with a given name; in newer versions of the fetch spec, it has been deleted, and headers.get() has been updated to fetch all header values instead of only the first one.
History.replaceState() - Web APIs
this method is particularly useful when you want to update the state object or url of the current history entry in response to some user action.
History - Web APIs
WebAPIHistory
replacestate() updates the most recent entry on the history stack to have the specified data, title, and, if provided, url.
IDBCursor.continuePrimaryKey() - Web APIs
your last visit: let request = articlestore.index("tag").opencursor(); let count = 0; let unreadlist = []; request.onsuccess = (event) => { let cursor = event.target.result; if (!cursor) { return; } let lastprimarykey = getlastiteratedarticleid(); if (lastprimarykey > cursor.primarykey) { cursor.continueprimarykey("javascript", lastprimarykey); return; } // update lastiteratedarticleid setlastiteratedarticleid(cursor.primarykey); // preload 5 articles into the unread list; unreadlist.push(cursor.value); if (++count < 5) { cursor.continue(); } }; specifications specification status comment indexed database api draftthe definition of 'continueprimarykey()' in that specification.
IDBCursor.delete() - Web APIs
WebAPIIDBCursordelete
be aware that you can't call delete() (or idbcursor.update()) on cursors obtained from idbindex.openkeycursor().
IDBObjectStore.createIndex() - Web APIs
has been deleted or removed.) in firefox previous to version 41, an invalidstateerror was raised in this case as well, which was misleading; this has now been fixed (see bug 1176165.) example in the following example you can see the idbopendbrequest.onupgradeneeded handler being used to update the database structure if a database with a higher version number is loaded.
IDBObjectStore.deleteIndex() - Web APIs
example in the following example you can see the idbopendbrequest.onupgradeneeded handler being used to update the database structure if a database with a higher version number is loaded.
IDBObjectStore.get() - Web APIs
once this data object is retrieved, you could then update it using normal javascript, then put it back into the database using a idbobjectstore.put operation.
IDBObjectStore.getKey() - Web APIs
example let openrequest = indexeddb.open("telemetry"); openrequest.onsuccess = (event) => { let db = event.target.result; let store = db.transaction("netlogs").objectstore("netlogs"); let today = new date(); let yesterday = new date(today); yesterday.setdate(today.getdate() - 1); let request = store.getkey(idbkeyrange(yesterday, today)); request.onsuccess = (event) => { let when = event.target.result; alert("the 1st activity in last 24 hours was occurred at " + when); }; }; specifications specification status comment indexed database api draftthe definit...
IDBOpenDBRequest.onupgradeneeded - Web APIs
}; example in the following example you can see the onupgradeneeded handler being used to update the database structure if a database with a higher version number is loaded.
IDBOpenDBRequest: upgradeneeded event - Web APIs
bubbles no cancelable no interface event event handler onupgradeneeded examples this example opens a database and handles the upgradeneeded event by making any necessary updates to the object store.
IDBOpenDBRequest - Web APIs
example in the following example you can see the onupgradeneeded handler being used to update the database structure if a database with a higher version number is loaded.
IDBVersionChangeRequest - Web APIs
methods inherits from: idbrequest idbversionchangerequest.setversion updates the version of the database.
Browser storage limits and eviction criteria - Web APIs
the "last access time" of origins is updated when any of these are activated/deactivated — origin eviction will delete data for all these quota clients.
enabled - Web APIs
example the following code uses the startsoftwareupdate method to unconditionally trigger a download from http://royalairways/royalpkg.xpi as long as software installation is enabled on the browser: if (installtrigger.enabled() ) { installtrigger.startsoftwareupdate ("http://royalair.com/rasoft.xpi"); } ...
getVersion - Web APIs
installing a component with a null version indicates that the component should always be updated when the opportunity arises.
IntersectionObserverEntry.isIntersecting - Web APIs
example in this simple example, an intersection callback is used to update a counter of how many targeted elements are currently intersecting with the intersection root.
Intersection Observer API - Web APIs
the resulting rectangle is then updated by intersecting it with the root intersection rectangle.
KeyboardEvent.getModifierState() - Web APIs
in old implementations and outdated specifications, it returned true when a modifier which is the typical modifier key for the shortcut key is pressed.
KeyframeEffect - Web APIs
animationeffect.updatetiming() updates the specified timing properties.
LargestContentfulPaint - Web APIs
// https://bugs.webkit.org/show_bug.cgi?id=209216 try { let lcp; const po = new performanceobserver((entrylist) => { const entries = entrylist.getentries(); const lastentry = entries[entries.length - 1]; // update `lcp` to the latest value, using `rendertime` if it's available, // otherwise using `loadtime`.
LocalFileSystemSync - Web APIs
about this document this document was last updated on march 2, 2012 and follows the w3c specifications (working draft) drafted on april 19, 2011.
LocalMediaStream - Web APIs
do not use localmediastream; you need to update any code that does use it as soon as possible or your content or application will stop working.
Location: href - Web APIs
WebAPILocationhref
the href property of the location interface is a stringifier that returns a usvstring containing the whole url, and allows the href to be updated.
LockedFile - Web APIs
methods lockedfile.getmetadata() allows to retrieve the file metadata (size and date of the last modification).
MediaDeviceInfo.deviceId - Web APIs
candidate recommendation initial definition.
MediaDeviceInfo.groupId - Web APIs
candidate recommendation initial definition.
MediaDeviceInfo.kind - Web APIs
candidate recommendation initial definition.
MediaDeviceInfo.label - Web APIs
candidate recommendation initial definition.
MediaDeviceInfo - Web APIs
candidate recommendation initial definition ...
MediaDevices.enumerateDevices() - Web APIs
candidate recommendation initial definition.
MediaDevices.getSupportedConstraints() - Web APIs
candidate recommendation initial definition.
MediaDevices - Web APIs
candidate recommendation initial definition ...
MediaKeySession - Web APIs
mediakeysession.update() returns a promise after loading messages and licenses to the cdm.
MediaList.mediaText - Web APIs
note that the medialist is a live list; updating the list via mediatext will immediately update the behavior of the document.
MediaList - Web APIs
WebAPIMediaList
note: medialist is a live list; updating the list using properties or methods listed below will immediately update the behavior of the document.
MediaQueryListListener - Web APIs
this feature is outdated.
MediaSource.activeSourceBuffers - Web APIs
example the following snippet is based on a simple example written by nick desaulniers (view the full demo live, or download the source for further investigation.) function sourceopen (_) { //console.log(this.readystate); // open var mediasource = this; var sourcebuffer = mediasource.addsourcebuffer(mimecodec); fetchab(asseturl, function (buf) { sourcebuffer.addeventlistener('updateend', function (_) { mediasource.endofstream(); console.log(mediasource.activesourcebuffers); // will contain the source buffer that was added above, // as it is selected for playing in the video player video.play(); //console.log(mediasource.readystate); // ended }); sourcebuffer.appendbuffer(buf); }); }; ...
MediaSource.addSourceBuffer() - Web APIs
= url.createobjecturl(mediasource); mediasource.addeventlistener('sourceopen', sourceopen); } else { console.error('unsupported mime type or codec: ', mimecodec); } function sourceopen (_) { //console.log(this.readystate); // open var mediasource = this; var sourcebuffer = mediasource.addsourcebuffer(mimecodec); fetchab(asseturl, function (buf) { sourcebuffer.addeventlistener('updateend', function (_) { mediasource.endofstream(); video.play(); //console.log(mediasource.readystate); // ended }); sourcebuffer.appendbuffer(buf); }); }; specifications specification status comment media source extensionsthe definition of 'addsourcebuffer()' in that specification.
MediaSource.isTypeSupported() - Web APIs
= url.createobjecturl(mediasource); mediasource.addeventlistener('sourceopen', sourceopen); } else { console.error('unsupported mime type or codec: ', mimecodec); } function sourceopen (_) { //console.log(this.readystate); // open var mediasource = this; var sourcebuffer = mediasource.addsourcebuffer(mimecodec); fetchab(asseturl, function (buf) { sourcebuffer.addeventlistener('updateend', function (_) { mediasource.endofstream(); video.play(); //console.log(mediasource.readystate); // ended }); sourcebuffer.appendbuffer(buf); }); }; specifications specification status comment media source extensionsthe definition of 'istypesupported()' in that specification.
MediaSource.readyState - Web APIs
= url.createobjecturl(mediasource); mediasource.addeventlistener('sourceopen', sourceopen); } else { console.error('unsupported mime type or codec: ', mimecodec); } function sourceopen (_) { //console.log(this.readystate); // open var mediasource = this; var sourcebuffer = mediasource.addsourcebuffer(mimecodec); fetchab(asseturl, function (buf) { sourcebuffer.addeventlistener('updateend', function (_) { mediasource.endofstream(); video.play(); //console.log(mediasource.readystate); // ended }); sourcebuffer.appendbuffer(buf); }); }; specifications specification status comment media source extensionsthe definition of 'readystate' in that specification.
MediaSource.sourceBuffers - Web APIs
example the following snippet is based on a simple example written by nick desaulniers (view the full demo live, or download the source for further investigation.) function sourceopen (_) { //console.log(this.readystate); // open var mediasource = this; var sourcebuffer = mediasource.addsourcebuffer(mimecodec); fetchab(asseturl, function (buf) { sourcebuffer.addeventlistener('updateend', function (_) { mediasource.endofstream(); console.log(mediasource.sourcebuffers); // will contain the source buffer that was added above video.play(); //console.log(mediasource.readystate); // ended }); sourcebuffer.appendbuffer(buf); }); }; ...
MediaSource - Web APIs
= url.createobjecturl(mediasource); mediasource.addeventlistener('sourceopen', sourceopen); } else { console.error('unsupported mime type or codec: ', mimecodec); } function sourceopen (_) { //console.log(this.readystate); // open var mediasource = this; var sourcebuffer = mediasource.addsourcebuffer(mimecodec); fetchab(asseturl, function (buf) { sourcebuffer.addeventlistener('updateend', function (_) { mediasource.endofstream(); video.play(); //console.log(mediasource.readystate); // ended }); sourcebuffer.appendbuffer(buf); }); }; function fetchab (url, cb) { console.log(url); var xhr = new xmlhttprequest; xhr.open('get', url); xhr.responsetype = 'arraybuffer'; xhr.onload = function () { cb(xhr.response); }; xhr.send(); }; spe...
MediaStream() - Web APIs
candidate recommendation ...
MediaStream.addTrack() - Web APIs
candidate recommendation initial specification.
MediaStream: addtrack event - Web APIs
candidate recommendation ...
MediaStream.clone() - Web APIs
WebAPIMediaStreamclone
candidate recommendation initial definition.
MediaStream.getAudioTracks() - Web APIs
candidate recommendation initial definition.
MediaStream.getTrackById() - Web APIs
candidate recommendation initial specification.
MediaStream.getTracks() - Web APIs
candidate recommendation initial definition.
MediaStream.getVideoTracks() - Web APIs
candidate recommendation initial definition.
MediaStream.id - Web APIs
WebAPIMediaStreamid
candidate recommendation initial definition.
MediaStream.onaddtrack - Web APIs
candidate recommendation initial specification.
MediaStream.onremovetrack - Web APIs
candidate recommendation initial specification.
MediaStream: removetrack event - Web APIs
candidate recommendation ...
MediaStream - Web APIs
candidate recommendation ...
MediaStreamConstraints.audio - Web APIs
candidate recommendation initial specification.
MediaStreamConstraints.video - Web APIs
candidate recommendation initial specification.
MediaStreamTrack.applyConstraints() - Web APIs
candidate recommendation initial definition.
MediaStreamTrack.clone() - Web APIs
candidate recommendation initial definition.
MediaStreamTrack: ended event - Web APIs
candidate recommendation initial specification.
MediaStreamTrack.getCapabilities() - Web APIs
candidate recommendation initial definition.
MediaStreamTrack.getSettings() - Web APIs
candidate recommendation initial definition.
MediaStreamTrack.id - Web APIs
candidate recommendation initial specification.
MediaStreamTrack.kind - Web APIs
candidate recommendation initial specification.
MediaStreamTrack.label - Web APIs
candidate recommendation initial specification.
MediaStreamTrack: mute event - Web APIs
candidate recommendation initial specification.
MediaStreamTrack.muted - Web APIs
candidate recommendation initial definition.
MediaStreamTrack.onended - Web APIs
candidate recommendation initial specification.
MediaStreamTrack.onmute - Web APIs
candidate recommendation initial specification.
MediaStreamTrack.onunmute - Web APIs
candidate recommendation initial specification.
MediaStreamTrack.readyState - Web APIs
candidate recommendation initial specification.
MediaStreamTrack.stop() - Web APIs
candidate recommendation initial specification.
MediaStreamTrack: unmute event - Web APIs
candidate recommendation initial specification.
MediaStreamTrackEvent() - Web APIs
candidate recommendation ...
MediaStreamTrackEvent - Web APIs
candidate recommendation ...
Recording a media element - Web APIs
lines 6-7 starts the recording process by calling recorder.start(), and outputs a message to the log with the updated state of the recorder and the number of seconds it will be recording.
MediaTrackConstraints.aspectRatio - Web APIs
candidate recommendation initial specification.
MediaTrackConstraints.autoGainControl - Web APIs
candidate recommendation initial specification.
MediaTrackConstraints.channelCount - Web APIs
candidate recommendation initial specification.
MediaTrackConstraints.echoCancellation - Web APIs
candidate recommendation initial specification.
MediaTrackConstraints.facingMode - Web APIs
candidate recommendation initial specification.
MediaTrackConstraints.frameRate - Web APIs
candidate recommendation initial specification.
MediaTrackConstraints.height - Web APIs
candidate recommendation initial specification.
MediaTrackConstraints.latency - Web APIs
candidate recommendation initial specification.
MediaTrackConstraints.noiseSuppression - Web APIs
candidate recommendation initial specification.
MediaTrackConstraints.sampleRate - Web APIs
candidate recommendation initial specification.
MediaTrackConstraints.sampleSize - Web APIs
candidate recommendation initial specification.
MediaTrackConstraints.width - Web APIs
candidate recommendation initial specification.
MediaTrackConstraints - Web APIs
specifications specification status comment media capture and streams candidate recommendation initial definition.
MediaTrackSettings.aspectRatio - Web APIs
candidate recommendation initial specification.
MediaTrackSettings.autoGainControl - Web APIs
candidate recommendation initial specification.
MediaTrackSettings.channelCount - Web APIs
candidate recommendation initial specification.
MediaTrackSettings.deviceId - Web APIs
candidate recommendation initial specification.
MediaTrackSettings.echoCancellation - Web APIs
candidate recommendation initial specification.
MediaTrackSettings.facingMode - Web APIs
candidate recommendation initial specification.
MediaTrackSettings.frameRate - Web APIs
candidate recommendation initial specification.
MediaTrackSettings.groupId - Web APIs
candidate recommendation initial specification.
MediaTrackSettings.height - Web APIs
candidate recommendation initial specification.
MediaTrackSettings.latency - Web APIs
candidate recommendation initial specification.
MediaTrackSettings.noiseSuppression - Web APIs
candidate recommendation initial specification.
MediaTrackSettings.sampleRate - Web APIs
candidate recommendation initial specification.
MediaTrackSettings.sampleSize - Web APIs
candidate recommendation initial specification.
MediaTrackSettings.width - Web APIs
candidate recommendation initial specification.
MediaTrackSupportedConstraints.aspectRatio - Web APIs
candidate recommendation initial specification.
MediaTrackSupportedConstraints.autoGainControl - Web APIs
candidate recommendation initial specification.
MediaTrackSupportedConstraints.channelCount - Web APIs
candidate recommendation initial specification.
MediaTrackSupportedConstraints.deviceId - Web APIs
candidate recommendation initial specification.
MediaTrackSupportedConstraints.echoCancellation - Web APIs
candidate recommendation initial specification.
MediaTrackSupportedConstraints.facingMode - Web APIs
candidate recommendation initial specification.
MediaTrackSupportedConstraints.frameRate - Web APIs
candidate recommendation initial specification.
MediaTrackSupportedConstraints.groupId - Web APIs
candidate recommendation initial specification.
MediaTrackSupportedConstraints.height - Web APIs
candidate recommendation initial specification.
MediaTrackSupportedConstraints.latency - Web APIs
candidate recommendation initial specification.
MediaTrackSupportedConstraints.noiseSuppression - Web APIs
candidate recommendation initial specification.
MediaTrackSupportedConstraints.sampleRate - Web APIs
candidate recommendation initial specification.
MediaTrackSupportedConstraints.sampleSize - Web APIs
candidate recommendation initial specification.
MediaTrackSupportedConstraints.width - Web APIs
candidate recommendation initial specification.
Media Capture and Streams API (Media Stream) - Web APIs
these no longer exist, and you should update any existing code to instead use mediastreamtrack directly.
MerchantValidationEvent.methodName - Web APIs
candidate recommendation initial definition.
MouseEvent.movementX - Web APIs
candidate recommendation initial definition ...
MouseEvent.movementY - Web APIs
candidate recommendation initial definition.
MouseEvent - Web APIs
candidate recommendation from document object model (dom) level 3 events specification, added movementx and movementy properties.
NamedNodeMap - Web APIs
a namednodemap object is live and will thus be auto-updated if changes are made to its contents internally or elsewhere.
Navigator.getBattery() - Web APIs
candidate recommendation initial definition ...
Navigator.mediaDevices - Web APIs
candidate recommendation initial definition.
Navigator.permissions - Web APIs
the navigator.permissions read-only property returns a permissions object that can be used to query and update permission status of apis covered by the permissions api.
Navigator.sendBeacon() - Web APIs
candidate recommendation initial definition ...
Navigator - Web APIs
WebAPINavigator
navigator.permissions read only returns a permissions object that can be used to query and update permission status of apis covered by the permissions api.
Network Information API - Web APIs
var connection = navigator.connection || navigator.mozconnection || navigator.webkitconnection; var type = connection.effectivetype; function updateconnectionstatus() { console.log("connection type changed from " + type + " to " + connection.effectivetype); type = connection.effectivetype; } connection.addeventlistener('change', updateconnectionstatus); preload large resources the connection object is useful for deciding whether to preload resources that take large amounts of bandwidth or memory.
Node.textContent - Web APIs
WebAPINodetextContent
moreover, since innertext takes css styles into account, reading the value of innertext triggers a reflow to ensure up-to-date computed styles.
Node - Web APIs
WebAPINode
nodelist being live means that if the children of the node change, the nodelist object is automatically updated.
NodeList.prototype.forEach() - Web APIs
WebAPINodeListforEach
candidate recommendation defines foreach on iterable declarations browser compatibility the compatibility table on this page is generated from structured data.
NodeList - Web APIs
WebAPINodeList
live nodelists in some cases, the nodelist is live, which means that changes in the dom automatically update the collection.
Notification.requestPermission() - Web APIs
syntax the latest spec has updated this method to a promise-based syntax that works like this: notification.requestpermission().then(function(permission) { ...
Notification.timestamp - Web APIs
var dts = math.floor(date.now()); var options = { body: 'do you like my body?', timestamp: dts } var n = new notification('test notification',options); console.log(n.timestamp) // should log original timestamp specifications specification status comment notifications apithe definition of 'timestamp' in that specification.
OrientationSensor.populateMatrix() - Web APIs
candidate recommendation initial definition.
OrientationSensor.quaternion - Web APIs
candidate recommendation initial definition.
OrientationSensor - Web APIs
candidate recommendation initial definition.
OverconstrainedError.OverconstrainedError() - Web APIs
candidate recommendation initial definition.
OverconstrainedError.constraint - Web APIs
candidate recommendation initial definition.
OverconstrainedError.message - Web APIs
candidate recommendation initial definition.
OverconstrainedError.name - Web APIs
candidate recommendation initial definition.
OverconstrainedError - Web APIs
candidate recommendation initial definition.
Page Visibility API - Web APIs
a site has an image carousel that shouldn't advance to the next slide unless the user is viewing the page an application showing a dashboard of information doesn't want to poll the server for updates when the page isn't visible a page wants to detect when it is being prerendered so it can keep accurate count of page views a site wants to switch off sounds when a device is in standby mode (user pushes power button to turn screen off) developers have historically used imperfect proxies to detect this.
PannerNode.coneInnerAngle - Web APIs
outer cone // setting it to 0 means there is no sound, so we can clearly hear when we leave the cone // 0 is also the default panner.coneoutergain = 0; // increase the z position to ensure the cone has an effect // (otherwise the sound is located at the same position as the listener) panner.positionz.setvalueattime(1, context.currenttime); having set up the pannernode, we can now schedule some updates to its y-axis rotation: // calculate the vector for no rotation // this means the sound will play at full volume const [x1, y1, z1] = yrotationtovector(0); // schedule the no-rotation vector immediately panner.orientationx.setvalueattime(x1, context.currenttime); panner.orientationy.setvalueattime(y1, context.currenttime); panner.orientationz.setvalueattime(z1, context.currenttime); // calcula...
PannerNode.coneOuterAngle - Web APIs
outer cone // setting it to 0 means there is no sound, so we can clearly hear when we leave the cone // 0 is also the default panner.coneoutergain = 0; // increase the z position to ensure the cone has an effect // (otherwise the sound is located at the same position as the listener) panner.positionz.setvalueattime(1, context.currenttime); having set up the pannernode, we can now schedule some updates to its y-axis rotation: // calculate the vector for no rotation // this means the sound will play at full volume const [x1, y1, z1] = yrotationtovector(0); // schedule the no-rotation vector immediately panner.orientationx.setvalueattime(x1, context.currenttime); panner.orientationy.setvalueattime(y1, context.currenttime); panner.orientationz.setvalueattime(z1, context.currenttime); // calcula...
PannerNode.coneOuterGain - Web APIs
outer cone // setting it to 0 means there is no sound, so we can clearly hear when we leave the cone // 0 is also the default panner.coneoutergain = 0; // increase the z position to ensure the cone has an effect // (otherwise the sound is located at the same position as the listener) panner.positionz.setvalueattime(1, context.currenttime); having set up the pannernode, we can now schedule some updates to its y-axis rotation: // calculate the vector for no rotation // this means the sound will play at full volume const [x1, y1, z1] = yrotationtovector(0); // schedule the no-rotation vector immediately panner.orientationx.setvalueattime(x1, context.currenttime); panner.orientationy.setvalueattime(y1, context.currenttime); panner.orientationz.setvalueattime(z1, context.currenttime); // calcula...
PannerNode.distanceModel - Web APIs
generally you will define the position in 3d space that your audio listener and panner (source) occupy initially, and then update the position of one or both of these as the application is used.
PannerNode.maxDistance - Web APIs
generally you will define the position in 3d space that your audio listener and panner (source) occupy initially, and then update the position of one or both of these as the application is used.
PannerNode.orientationX - Web APIs
outer cone // setting it to 0 means there is no sound, so we can clearly hear when we leave the cone // 0 is also the default panner.coneoutergain = 0; // increase the z position to ensure the cone has an effect // (otherwise the sound is located at the same position as the listener) panner.positionz.setvalueattime(1, context.currenttime); having set up the pannernode, we can now schedule some updates to its y-axis rotation: // calculate the vector for no rotation // this means the sound will play at full volume const [x1, y1, z1] = yrotationtovector(0); // schedule the no-rotation vector immediately panner.orientationx.setvalueattime(x1, context.currenttime); panner.orientationy.setvalueattime(y1, context.currenttime); panner.orientationz.setvalueattime(z1, context.currenttime); // calcula...
PannerNode.orientationY - Web APIs
outer cone // setting it to 0 means there is no sound, so we can clearly hear when we leave the cone // 0 is also the default panner.coneoutergain = 0; // increase the z position to ensure the cone has an effect // (otherwise the sound is located at the same position as the listener) panner.positionz.setvalueattime(1, context.currenttime); having set up the pannernode, we can now schedule some updates to its y-axis rotation: // calculate the vector for no rotation // this means the sound will play at full volume const [x1, y1, z1] = yrotationtovector(0); // schedule the no-rotation vector immediately panner.orientationx.setvalueattime(x1, context.currenttime); panner.orientationy.setvalueattime(y1, context.currenttime); panner.orientationz.setvalueattime(z1, context.currenttime); // calcula...
PannerNode.orientationZ - Web APIs
outer cone // setting it to 0 means there is no sound, so we can clearly hear when we leave the cone // 0 is also the default panner.coneoutergain = 0; // increase the z position to ensure the cone has an effect // (otherwise the sound is located at the same position as the listener) panner.positionz.setvalueattime(1, context.currenttime); having set up the pannernode, we can now schedule some updates to its y-axis rotation: // calculate the vector for no rotation // this means the sound will play at full volume const [x1, y1, z1] = yrotationtovector(0); // schedule the no-rotation vector immediately panner.orientationx.setvalueattime(x1, context.currenttime); panner.orientationy.setvalueattime(y1, context.currenttime); panner.orientationz.setvalueattime(z1, context.currenttime); // calcula...
PannerNode.panningModel - Web APIs
generally you will define the position in 3d space that your audio listener and panner (source) occupy initially, and then update the position of one or both of these as the application is used.
PannerNode.setOrientation() - Web APIs
generally you will define the position in 3d space that your audio listener and panner (source) occupy initially, and then update the position of one or both of these as the application is used.
PannerNode.setPosition() - Web APIs
generally you will define the position in 3d space that your audio listener and panner (source) occupy initially, and then update the position of one or both of these as the application is used.
PannerNode.setVelocity() - Web APIs
generally you will define the position in 3d space that your audio listener and panner (source) occupy initially, and then update the position of one or both of these as the application is used.
PannerNode - Web APIs
generally you will define the position in 3d space that your audio listener and panner (source) occupy initially, and then update the position of one or both of these as the application is used.
PayerErrors - Web APIs
candidate recommendation initial definition.
PaymentAddress.addressLine - Web APIs
candidate recommendation initial definition.
PaymentAddress.city - Web APIs
candidate recommendation initial definition.
PaymentAddress.dependentLocality - Web APIs
candidate recommendation initial definition.
PaymentAddress.organization - Web APIs
candidate recommendation initial definition.
PaymentAddress.phone - Web APIs
candidate recommendation initial definition.
PaymentAddress.postalCode - Web APIs
candidate recommendation initial definition.
PaymentAddress.recipient - Web APIs
candidate recommendation initial definition.
PaymentAddress.region - Web APIs
candidate recommendation initial definition.
PaymentAddress.sortingCode - Web APIs
candidate recommendation initial definition.
PaymentAddress.toJSON() - Web APIs
candidate recommendation initial definition.
PaymentAddress - Web APIs
candidate recommendation initial definition.
PaymentCurrencyAmount.currency - Web APIs
candidate recommendation ...
PaymentCurrencyAmount - Web APIs
candidate recommendation initial definition.
PaymentItem - Web APIs
candidate recommendation initial definition.
PaymentMethodChangeEvent - Web APIs
candidate recommendation initial definition.
PaymentRequest.PaymentRequest() - Web APIs
candidate recommendation initial definition.
PaymentRequest.abort() - Web APIs
candidate recommendation initial definition.
PaymentRequest.canMakePayment() - Web APIs
candidate recommendation initial definition.
PaymentRequest.prototype.id - Web APIs
WebAPIPaymentRequestid
candidate recommendation initial definition.
PaymentRequest.shippingType - Web APIs
candidate recommendation initial definition.
PaymentResponse.complete() - Web APIs
candidate recommendation initial definition.
PaymentResponse.details - Web APIs
var paymentdata = { // payment method string method: paymentresponse.methodname, // payment details as you requested details: paymentresponse.details, // shipping address information address: todict(paymentresponse.shippingaddress) }; // send information to the server }); specifications specification status comment payment request api candidate recommendation initial definition.
PaymentResponse.methodName - Web APIs
var paymentdata = { // payment method string method: paymentresponse.methodname, // payment details as you requested details: paymentresponse.details, // shipping address information address: todict(paymentresponse.shippingaddress) }; // send information to the server }); specifications specification status comment payment request api candidate recommendation initial definition.
PaymentResponse.payerEmail - Web APIs
syntax var payeremail = paymentresponse.payeremail; specifications specification status comment payment request api candidate recommendation initial definition.
PaymentRequest.payerName - Web APIs
candidate recommendation initial definition.
PayerResponse.payerPhone - Web APIs
syntax var payerphone = paymentresponse.payerphone; specifications specification status comment payment request api candidate recommendation initial definition.
PaymentResponse.requestId - Web APIs
candidate recommendation initial definition.
PaymentValidationErrors - Web APIs
example specifications specification status comment payment request api candidate recommendation initial definition.
Using the Payment Request API - Web APIs
in the following snippet, a merchant page performs this check, and if it returns true updates the checkout button to use paymentrequest instead of legacy web forms.
performance.clearResourceTimings() - Web APIs
candidate recommendation initial definition.
performance.getEntries() - Web APIs
candidate recommendation performance timelinethe definition of 'getentries()' in that specification.
performance.getEntriesByName() - Web APIs
candidate recommendation performance timelinethe definition of 'getentriesbyname()' in that specification.
performance.getEntriesByType() - Web APIs
candidate recommendation performance timelinethe definition of 'getentriesbytype()' in that specification.
Performance.onresourcetimingbufferfull - Web APIs
candidate recommendation initial definition.
Performance: resourcetimingbufferfull event - Web APIs
candidate recommendation initial definition.
performance.setResourceTimingBufferSize() - Web APIs
candidate recommendation initial definition.
PerformanceEntry.duration - Web APIs
candidate recommendation performance timelinethe definition of 'duration' in that specification.
PerformanceEntry.entryType - Web APIs
candidate recommendation performance timelinethe definition of 'entrytype' in that specification.
PerformanceEntry.name - Web APIs
candidate recommendation performance timelinethe definition of 'name' in that specification.
PerformanceEntry.startTime - Web APIs
candidate recommendation performance timelinethe definition of 'starttime' in that specification.
PerformanceEntry.toJSON() - Web APIs
candidate recommendation initial definition of tojson() method.
PerformanceEventTiming - Web APIs
auxclick beforeinput click compositionend compositionstart compositionupdate contextmenu dblclick dragend dragenter dragleave dragover dragstart drop input keydown keypress keyup mousedown mouseenter mouseleave mouseout mouseover mouseup pointerover pointerenter pointerdown pointerup pointercancel pointerout pointerleave gotpointercapture lostpointercapture touchstart touchend touchcancel properties performanceeventtiming.processingstart returns the time at which event dispatch started.
PerformanceObserver() - Web APIs
candidate recommendation initial definition of performanceobserver() constructor.
PeformanceObserver.disconnect() - Web APIs
candidate recommendation initial definition of disconnect() method.
PerformanceObserver.observe() - Web APIs
candidate recommendation initial definition of observe() method.
PerformanceObserver.takeRecords() - Web APIs
candidate recommendation initial definition of takerecords() method.
PerformanceObserver - Web APIs
candidate recommendation initial definition of performanceobserver interface.
PerformanceObserverEntryList.getEntries() - Web APIs
candidate recommendation initial definition.
PerformanceObserverEntryList.getEntriesByName() - Web APIs
candidate recommendation initial definition of getentriesbyname() method.
PerformanceObserverEntryList.getEntriesByType() - Web APIs
candidate recommendation initial definition of getentriesbytype() method.
PerformanceObserverEntryList - Web APIs
candidate recommendation initial definition.
PerformanceResourceTiming.connectEnd - Web APIs
candidate recommendation initial definition.
PerformanceResourceTiming.connectStart - Web APIs
candidate recommendation initial definition.
PerformanceResourceTiming.domainLookupEnd - Web APIs
candidate recommendation initial definition.
PerformanceResourceTiming.domainLookupStart - Web APIs
candidate recommendation initial definition.
PerformanceResourceTiming.fetchStart - Web APIs
candidate recommendation initial definition.
PerformanceResourceTiming.initiatorType - Web APIs
candidate recommendation initial definition.
PerformanceResourceTiming.redirectEnd - Web APIs
candidate recommendation initial definition.
PerformanceResourceTiming.redirectStart - Web APIs
candidate recommendation initial definition.
PerformanceResourceTiming.requestStart - Web APIs
candidate recommendation initial definition.
PerformanceResourceTiming.responseEnd - Web APIs
candidate recommendation initial definition.
PerformanceResourceTiming.responseStart - Web APIs
candidate recommendation initial definition.
PerformanceResourceTiming.secureConnectionStart - Web APIs
candidate recommendation initial definition.
PerformanceResourceTiming - Web APIs
candidate recommendation initial definition.
Permissions.query() - Web APIs
WebAPIPermissionsquery
an up-to-date list of permission names can be found in the spec under the permissionname enum, but bear in mind that the actual permissions supported by browsers is currently much smaller than this.
Pinch zoom gestures - Web APIs
log("pointermove", ev); ev.target.style.border = "dashed"; // find this event in the cache and update its record with this event for (var i = 0; i < evcache.length; i++) { if (ev.pointerid == evcache[i].pointerid) { evcache[i] = ev; break; } } // if two pointers are down, check for pinch gestures if (evcache.length == 2) { // calculate the distance between the two pointers var curdiff = math.abs(evcache[0].clientx - evcache[1].clientx); if (prevdiff > 0) { if (c...
PushManager.unregister() - Web APIs
in the updated api, a subscription is can be unregistered via the pushsubscription.unsubscribe() method.
PushManager - Web APIs
in the updated api, a subscription is unregistered by calling the pushsubscription.unsubscribe() method.
PushSubscription.endpoint - Web APIs
example navigator.serviceworker.ready.then(function(reg) { reg.pushmanager.subscribe({uservisibleonly: true}).then(function(subscription) { console.log(subscription.endpoint); // at this point you would most likely send the subscription // endpoint to your server, save it, then use it to send a // push message at a later date }) }) specifications specification status comment push apithe definition of 'endpoint' in that specification.
Web Push API Notifications best practices - Web APIs
for example, if the user views more than one article, or lingers on your page for several minutes, they may be interested in receiving updates.
RTCAnswerOptions - Web APIs
candidate recommendation initial definition.
RTCConfiguration.bundlePolicy - Web APIs
candidate recommendation initial definition.
RTCConfiguration.certificates - Web APIs
candidate recommendation initial definition.
RTCConfiguration.iceServers - Web APIs
candidate recommendation initial definition.
RTCDTMFSender.insertDTMF() - Web APIs
candidate recommendation ...
RTCDTMFSender.ontonechange - Web APIs
candidate recommendation ...
RTCDTMFSender.toneBuffer - Web APIs
candidate recommendation ...
RTCDTMFSender - Web APIs
candidate recommendation ...
RTCDTMFToneChangeEvent.RTCDTMFToneChangeEvent() - Web APIs
candidate recommendation initial definition.
RTCDTMFToneChangeEvent - Web APIs
candidate recommendation initial definition.
RTCDataChannel.binaryType - Web APIs
candidate recommendation initial specification.
RTCDataChannel.bufferedAmount - Web APIs
candidate recommendation initial specification.
RTCDataChannel.bufferedAmountLowThreshold - Web APIs
candidate recommendation initial specification.
RTCDataChannel: bufferedamountlow event - Web APIs
candidate recommendation ...
RTCDataChannel.close() - Web APIs
candidate recommendation initial specification.
RTCDataChannel: error event - Web APIs
candidate recommendation initial specification.
RTCDataChannel.label - Web APIs
candidate recommendation initial specification.
RTCDataChannel.maxPacketLifeTime - Web APIs
candidate recommendation initial specification.
RTCDataChannel.maxRetransmits - Web APIs
candidate recommendation initial specification.
RTCDataChannel: message event - Web APIs
candidate recommendation ...
RTCDataChannel.negotiated - Web APIs
candidate recommendation initial specification.
RTCDataChannel.onbufferedamountlow - Web APIs
candidate recommendation initial specification.
RTCDataChannel.onclose - Web APIs
candidate recommendation initial specification.
RTCDataChannel.onclosing - Web APIs
candidate recommendation initial specification.
RTCDataChannel.onerror - Web APIs
candidate recommendation initial specification.
RTCDataChannel.onmessage - Web APIs
candidate recommendation initial specification.
RTCDataChannel.ordered - Web APIs
candidate recommendation initial specification.
RTCDataChannel.protocol - Web APIs
candidate recommendation initial specification.
RTCDataChannel.readyState - Web APIs
candidate recommendation initial specification.
RTCDataChannel.reliable - Web APIs
use rtcdatachannel.ordered instead in any new code, and update existing code as soon as possible.
RTCDataChannel.stream - Web APIs
if you have code that uses stream, you will need to update, since browsers have begun to remove support for stream.
RTCDataChannel - Web APIs
candidate recommendation initial specification.
RTCDataChannelEvent() - Web APIs
candidate recommendation initial specification.
RTCDataChannelEvent.channel - Web APIs
candidate recommendation initial specification.
RTCDataChannelEvent - Web APIs
candidate recommendation initial definition.
RTCDtlsTransport.iceTransport - Web APIs
candidate recommendation initial definition.
RTCError - Web APIs
WebAPIRTCError
candidate recommendation initial definition.
RTCErrorEvent.error - Web APIs
candidate recommendation initial definition.
RTCIceCredentialType - Web APIs
candidate recommendation initial specification.
RTCIceParameters.password - Web APIs
candidate recommendation initial specification.
RTCIceServer.credential - Web APIs
candidate recommendation initial specification.
RTCIceServer.credentialType - Web APIs
candidate recommendation initial specification.
RTCIceServer.url - Web APIs
WebAPIRTCIceServerurl
try to update any existing code to use that property instead.
RTCIceServers.urls - Web APIs
WebAPIRTCIceServerurls
candidate recommendation initial specification.
RTCIceServer.username - Web APIs
candidate recommendation initial specification.
RTCIceServer - Web APIs
because many older books and examples still use this, we include it to help developers update their code or make sense of older examples.
RTCIceTransport.getLocalParameters() - Web APIs
candidate recommendation initial specification.
RTCIceTransport.getRemoteParameters() - Web APIs
candidate recommendation initial specification.
RTCIceTransport.onstatechange - Web APIs
candidate recommendation initial specification.
RTCIdentityAssertion - Web APIs
specifications specification status comment webrtc 1.0: real-time communication between browsers candidate recommendation initial definition.
RTCInboundRtpStreamStats.averageRtcpInterval - Web APIs
candidate recommendation initial definition.
RTCInboundRtpStreamStats.bytesReceived - Web APIs
candidate recommendation initial definition.
RTCInboundRtpStreamStats.fecPacketsDiscarded - Web APIs
candidate recommendation initial definition.
RTCInboundRtpStreamStats.fecPacketsReceived - Web APIs
candidate recommendation initial definition.
RTCInboundRtpStreamStats.firCount - Web APIs
candidate recommendation initial definition.
RTCInboundRtpStreamStats.framesDecoded - Web APIs
candidate recommendation initial definition.
RTCInboundRtpStreamStats.lastPacketReceivedTimestamp - Web APIs
candidate recommendation initial definition.
RTCInboundRtpStreamStats.nackCount - Web APIs
candidate recommendation initial definition.
RTCInboundRtpStreamStats.packetsDuplicated - Web APIs
candidate recommendation initial definition.
RTCInboundRtpStreamStats.packetsFailedDecryption - Web APIs
candidate recommendation initial definition.
RTCInboundRtpStreamStats.perDscpPacketsReceived - Web APIs
candidate recommendation initial definition.
RTCInboundRtpStreamStats.pliCount - Web APIs
candidate recommendation initial definition.
RTCInboundRtpStreamStats.receiverId - Web APIs
candidate recommendation initial definition.
RTCInboundRtpStreamStats.remoteId - Web APIs
candidate recommendation initial definition.
RTCInboundRtpStreamStats.sliCount - Web APIs
candidate recommendation initial definition.
RTCInboundRtpStreamStats.trackId - Web APIs
candidate recommendation initial definition.
RTCInboundRtpStreamStats - Web APIs
candidate recommendation initial specification.
RTCOfferAnswerOptions - Web APIs
candidate recommendation initial definition.
RTCOfferOptions.iceRestart - Web APIs
candidate recommendation initial definition.
RTCOfferOptions - Web APIs
candidate recommendation initial definition.
RTCOutboundRtpStreamStats.averageRtcpInterval - Web APIs
candidate recommendation initial definition.
RTCOutboundRtpStreamStats.firCount - Web APIs
candidate recommendation initial definition.
RTCOutboundRtpStreamStats.framesEncoded - Web APIs
candidate recommendation initial definition.
RTCOutboundRtpStreamStats.lastPacketSentTimestamp - Web APIs
candidate recommendation initial definition.
RTCOutboundRtpStreamStats.nackCount - Web APIs
candidate recommendation initial definition.
RTCOutboundRtpStreamStats.perDscpPacketsSent - Web APIs
candidate recommendation initial definition.
RTCOutboundRtpStreamStats.pliCount - Web APIs
candidate recommendation initial definition.
RTCOutboundRtpStreamStats.qualityLimitationReason - Web APIs
candidate recommendation initial definition.
RTCOutboundRtpStreamStats.remoteId - Web APIs
candidate recommendation initial definition.
RTCOutboundRtpStreamStats.sliCount - Web APIs
candidate recommendation initial definition.
RTCOutboundRtpStreamStats.trackId - Web APIs
candidate recommendation initial definition.
RTCOutboundRtpStreamStats - Web APIs
candidate recommendation initial specification.
RTCPeerConnection.addTransceiver() - Web APIs
candidate recommendation ...
RTCPeerConnection.close() - Web APIs
candidate recommendation initial specification.
RTCPeerConnection.connectionState - Web APIs
candidate recommendation initial specification.
RTCPeerConnection: datachannel event - Web APIs
candidate recommendation basic definition.
RTCPeerConnection.generateCertificate() - Web APIs
candidate recommendation initial definition.
RTCPeerConnection.getConfiguration() - Web APIs
candidate recommendation initial definition.
RTCPeerConnection.getIdentityAssertion() - Web APIs
candidate recommendation initial specification.
RTCPeerConnection.getReceivers() - Web APIs
candidate recommendation initial specification.
RTCPeerConnection.getSenders() - Web APIs
candidate recommendation initial specification.
RTCPeerConnection.getStreamById() - Web APIs
if you have code that uses stream, you will need to update, since browsers have begun to remove support for stream.
RTCPeerConnection.getTransceivers() - Web APIs
candidate recommendation ...
RTCPeerConnection: idpassertionerror event - Web APIs
candidate recommendation ...
RTCPeerConnection: idpvalidationerror event - Web APIs
candidate recommendation ...
RTCPeerConnection.localDescription - Web APIs
candidate recommendation initial specification.
RTCPeerConnection.onaddstream - Web APIs
it is included here in order to help you adapt existing code and understand existing samples, which may not be up-to-date yet.
RTCPeerConnection.onconnectionstatechange - Web APIs
candidate recommendation initial specification.
RTCPeerConnection.ondatachannel - Web APIs
candidate recommendation initial specification.
RTCPeerConnection.oniceconnectionstatechange - Web APIs
candidate recommendation initial specification.
RTCPeerConnection.onnegotiationneeded - Web APIs
candidate recommendation initial specification.
RTCPeerConnection.onpeeridentity - Web APIs
such an event is sent when an identity assertion, received from a peer, has been successfully validated.
RTCPeerConnection.onsignalingstatechange - Web APIs
candidate recommendation initial specification.
RTCPeerConnection.ontrack - Web APIs
candidate recommendation initial specification.
RTCPeerConnection: peeridentity event - Web APIs
candidate recommendation ...
RTCPeerConnection.pendingLocalDescription - Web APIs
candidate recommendation initial specification.
RTCPeerConnection.pendingRemoteDescription - Web APIs
candidate recommendation initial specification.
RTCPeerConnection.remoteDescription - Web APIs
candidate recommendation initial specification.
RTCPeerConnection.removeTrack() - Web APIs
candidate recommendation initial specification.
RTCPeerConnection.sctp - Web APIs
candidate recommendation initial specification.
RTCPeerConnection.setConfiguration() - Web APIs
candidate recommendation initial definition.
RTCPeerConnection.setIdentityProvider() - Web APIs
candidate recommendation ...
RTCPeerConnection: track event - Web APIs
candidate recommendation initial specification.
RTCRemoteOutboundRtpStreamStats.remoteTimestamp - Web APIs
candidate recommendation initial definition.
RTCRemoteOutboundRtpStreamStats - Web APIs
candidate recommendation initial definition.
RTCRtcpParameters - Web APIs
candidate recommendation initial definition.
RTCRtpCapabilities - Web APIs
candidate recommendation ...
RTCRtpCodecCapability - Web APIs
candidate recommendation ...
RTCRtpContributingSource.audioLevel - Web APIs
candidate recommendation initial definition.
RTCRtpContributingSource.rtpTimestamp - Web APIs
candidate recommendation initial definition.
RTCRtpContributingSource.source - Web APIs
candidate recommendation initial definition.
RTCRtpContributingSource.timestamp - Web APIs
candidate recommendation initial definition.
RTCRtpContributingSource - Web APIs
candidate recommendation initial definition.
RTCRtpEncodingParameters.maxBitrate - Web APIs
candidate recommendation initial definition.
RTCRtpEncodingParameters.scaleResolutionDownBy - Web APIs
candidate recommendation initial definition.
RTCRtpEncodingParameters - Web APIs
candidate recommendation initial definition.
RTCRtpParameters - Web APIs
candidate recommendation initial definition.
RTCRtpReceiveParameters - Web APIs
candidate recommendation initial definition.
RTCRtpReceiver.getCapabilities() static function - Web APIs
candidate recommendation ...
RTCRtpReceiver.getContributingSources() - Web APIs
candidate recommendation initial definition.
RTCRtpReceiver.getParameters() - Web APIs
candidate recommendation initial definition.
RTCRtpReceiver.getSynchronizationSources() - Web APIs
candidate recommendation initial definition.
RTCRtpReceiver.track - Web APIs
candidate recommendation initial definition.
RTCRtpReceiver.transport - Web APIs
candidate recommendation ...
RTCRtpReceiver - Web APIs
candidate recommendation initial definition.
RTCRtpSendParameters.encodings - Web APIs
candidate recommendation initial definition.
RTCRtpSendParameters - Web APIs
candidate recommendation initial definition.
RTCRtpSender.dtmf - Web APIs
WebAPIRTCRtpSenderdtmf
candidate recommendation ...
RTCRtpSender.getCapabilities() static function - Web APIs
candidate recommendation ...
RTCRtpSender.getParameters() - Web APIs
candidate recommendation initial definition.
RTCRtpSender.replaceTrack() - Web APIs
candidate recommendation ...
RTCRtpSender.setStreams() - Web APIs
candidate recommendation ...
RTCRtpSender.track - Web APIs
candidate recommendation initial definition.
RTCRtpSender.transport - Web APIs
candidate recommendation ...
RTCRtpSender - Web APIs
candidate recommendation ...
RTCRtpStreamStats.codecId - Web APIs
candidate recommendation initial definition.
RTCRtpStreamStats.kind - Web APIs
candidate recommendation initial definition.
RTCRtpStreamStats.trackId - Web APIs
candidate recommendation initial definition.
RTCRtpStreamStats.transportId - Web APIs
candidate recommendation initial definition.
RTCRtpSynchronizationSource.voiceActivityFlag - Web APIs
candidate recommendation initial definition.
RTCRtpSynchronizationSource - Web APIs
candidate recommendation initial definition.
RTCRtpTransceiver.currentDirection - Web APIs
candidate recommendation ...
RTCRtpTransceiver.direction - Web APIs
candidate recommendation ...
RTCRtpTransceiver.mid - Web APIs
candidate recommendation ...
RTCRtpTransceiver.receiver - Web APIs
candidate recommendation ...
RTCRtpTransceiver.sender - Web APIs
candidate recommendation ...
RTCRtpTransceiver.setCodecPreferences() - Web APIs
candidate recommendation ...
RTCRtpTransceiver.stop() - Web APIs
candidate recommendation ...
RTCRtpTransceiver - Web APIs
candidate recommendation ...
RTCRtpTransceiverDirection - Web APIs
candidate recommendation ...
RTCRtpTransceiverInit - Web APIs
candidate recommendation ...
RTCSctpTransport.state - Web APIs
candidate recommendation initial definition.
RTCSctpTransport - Web APIs
candidate recommendation initial definition.
RTCSessionDescription() - Web APIs
candidate recommendation initial specification.
RTCSessionDescription.sdp - Web APIs
candidate recommendation initial specification.
RTCSessionDescription.toJSON() - Web APIs
candidate recommendation initial specification.
RTCSessionDescription.type - Web APIs
candidate recommendation initial specification.
RTCSessionDescriptionCallback - Web APIs
candidate recommendation initial definition.
RTCStats.id - Web APIs
WebAPIRTCStatsid
candidate recommendation initial definition.
RTCStats.timestamp - Web APIs
candidate recommendation initial definition.
RTCStats.type - Web APIs
WebAPIRTCStatstype
candidate recommendation initial definition.
RTCStats - Web APIs
WebAPIRTCStats
candidate recommendation initial specification.
RTCTrackEvent() - Web APIs
candidate recommendation initial specification.
RTCTrackEvent.receiver - Web APIs
candidate recommendation initial specification.
RTCTrackEvent.streams - Web APIs
candidate recommendation initial specification.
RTCTrackEvent.track - Web APIs
candidate recommendation initial specification.
RTCTrackEvent.transceiver - Web APIs
candidate recommendation initial specification.
RTCTrackEvent - Web APIs
candidate recommendation initial specification.
RTCTrackEventInit.receiver - Web APIs
candidate recommendation initial specification.
RTCTrackEventInit.streams - Web APIs
candidate recommendation initial specification.
RTCTrackEventInit.track - Web APIs
candidate recommendation initial specification.
RTCTrackEventInit.transceiver - Web APIs
candidate recommendation initial specification.
RTCTrackEventInit - Web APIs
candidate recommendation initial specification.
RelativeOrientationSensor.RelativeOrientationSensor() - Web APIs
candidate recommendation initial definition.
RelativeOrientationSensor - Web APIs
candidate recommendation initial definition.
Request() - Web APIs
WebAPIRequestRequest
note the following behavioural updates to retain security while making the constructor less likely to throw exceptions: if this object exists on another origin to the constructor call, the request.referrer is stripped out.
ResizeObserverEntry.target - Web APIs
to grab a reference to the observed element so we can update its border-radius value after each change, we make use of the target property of each entry — entry.target.style.borderradius.
SVGAElement - Web APIs
not _blank"); } } specifications specification status comment scalable vector graphics (svg) 2 candidate recommendation replaced inheritance from svgelement by svggraphicselement and removed the interface implementations of svgtests, svglangspace, svgexternalresourcesrequired, svgstylable, and svgtransformable by htmlhyperlinkelementutils scalable vector graphics (svg) 1.1 (second edition) recommendation initial definition ...
SVGAnimatedString.animVal - Web APIs
syntax var = object.animval specifications specification status comment scalable vector graphics (svg) 1.1 (second edition) recommendation scalable vector graphics (svg) 2 candidate recommendation browser compatibility the compatibility table on this page is generated from structured data.
SVGAnimatedString.baseVal - Web APIs
specifications specification status comment scalable vector graphics (svg) 1.1 (second edition) recommendation scalable vector graphics (svg) 2 candidate recommendation browser compatibility the compatibility table on this page is generated from structured data.
SVGAnimatedString - Web APIs
specifications specification status comment scalable vector graphics (svg) 1.1 (second edition) recommendation scalable vector graphics (svg) 2 candidate recommendation browser compatibility the compatibility table on this page is generated from structured data.
SVGAnimationElement: beginEvent event - Web APIs
candidate recommendation initial definition ...
SVGAnimationElement: endEvent event - Web APIs
candidate recommendation initial definition ...
SVGAnimationElement: repeatEvent event - Web APIs
candidate recommendation initial definition ...
cx - Web APIs
candidate recommendation no change scalable vector graphics (svg) 1.1 (second edition)the definition of 'svgcircleelement.cx' in that specification.
cy - Web APIs
candidate recommendation no change scalable vector graphics (svg) 1.1 (second edition)the definition of 'svgcircleelement.cy' in that specification.
r - Web APIs
candidate recommendation no change scalable vector graphics (svg) 1.1 (second edition)the definition of 'svgcircleelement.r' in that specification.
SVGCircleElement - Web APIs
candidate recommendation replaced the inheritance from svgelement, svgtests, svglangspace, svgexternalresourcesrequired, svgstylable, and svgtransformable by svggeometryelement scalable vector graphics (svg) 1.1 (second edition)the definition of 'svgcircleelement' in that specification.
SVGClipPathElement - Web APIs
candidate recommendation removed the inheritance from svgtests, svglangspace, svgexternalresourcesrequired, svgstylable, svgtransformable, and svgunittypes scalable vector graphics (svg) 1.1 (second edition)the definition of 'svgclippathelement' in that specification.
SVGDefsElement - Web APIs
candidate recommendation replaced the inheritance from svgelementsvgtests, svglangspace, svgexternalresourcesrequired, svgstylable, and svgtransformable by svggraphicselement scalable vector graphics (svg) 1.1 (second edition)the definition of 'svgdefselement' in that specification.
SVGDescElement - Web APIs
candidate recommendation removed the inheritance from svglangspace and svgstylable scalable vector graphics (svg) 1.1 (second edition)the definition of 'svgdescelement' in that specification.
SVGElement: error event - Web APIs
candidate recommendation initial definition ...
SVGElement: load event - Web APIs
candidate recommendation initial definition ...
SVGElement: resize event - Web APIs
candidate recommendation initial definition ...
SVGElement: scroll event - Web APIs
candidate recommendation initial definition ...
SVGElement: unload event - Web APIs
candidate recommendation initial definition ...
SVGElement - Web APIs
candidate recommendation adds the dataset property.
SVGEllipseElement - Web APIs
candidate recommendation no change scalable vector graphics (svg) 1.1 (second edition)the definition of 'svgellipseelement' in that specification.
SVGForeignObjectElement - Web APIs
candidate recommendation replaced the inheritance from svgelement, svgtests, svglangspace, svgexternalresourcesrequired, svgstylable, and svgtransformable by svggraphicselement and svgurireference scalable vector graphics (svg) 1.1 (second edition)the definition of 'svgforeignobjectelement' in that specification.
SVGGElement - Web APIs
candidate recommendation changed the inheritance from svgelement to svggraphicselement and removed the implemented interfaces svgtests, svglangspace, svgexternalresourcesrequired, svgstylable, and svgtransformable.
SVGGeometryElement.getPointAtLength() - Web APIs
candidate recommendation initial definition ...
SVGGeometryElement.getTotalLength() - Web APIs
candidate recommendation initial definition ...
SVGGeometryElement.isPointInFill() - Web APIs
candidate recommendation initial definition ...
SVGGeometryElement.isPointInStroke() - Web APIs
candidate recommendation initial definition ...
SVGGeometryElement.pathLength - Web APIs
candidate recommendation initial definition ...
SVGGeometryElement - Web APIs
candidate recommendation initial definition ...
SVGGradientElement - Web APIs
candidate recommendation removed inheritance of svgexternalresourcesrequired, svgstylable, and svgunittypes scalable vector graphics (svg) 1.1 (second edition)the definition of 'svggradientelement' in that specification.
SVGGraphicsElement: copy event - Web APIs
height: 90%; box-sizing: border-box; border: 1px solid black; } javascript document.getelementsbytagname("text")[0].addeventlistener("copy", evt => { evt.clipboarddata.setdata('text/plain', document.getselection().tostring().touppercase()); evt.preventdefault(); }); result specifications specification status comment scalable vector graphics (svg) 2 candidate recommendation definition that the clipboard events apply to svg elements.
SVGGraphicsElement: paste event - Web APIs
height: 90%; box-sizing: border-box; border: 1px solid black; } javascript document.getelementbyid("element-to-paste-text").addeventlistener("paste", evt => { evt.target.textcontent = evt.clipboarddata.getdata("text/plain").touppercase(); evt.preventdefault(); }); result specifications specification status comment scalable vector graphics (svg) 2 candidate recommendation definition that the clipboard events apply to svg elements.
SVGGraphicsElement - Web APIs
candidate recommendation initial definition ...
SVGImageElement.decode - Web APIs
specifications specification status comment scalable vector graphics (svg) 2 candidate recommendation initial definition.
SVGImageElement.height - Web APIs
candidate recommendation initial definition.
SVGImageElement.preserveAspectRatio - Web APIs
candidate recommendation scalable vector graphics (svg) 1.1 (second edition)the definition of 'preserveaspectratio' in that specification.
SVGImageElement.width - Web APIs
candidate recommendation initial definition.
SVGImageElement.x - Web APIs
WebAPISVGImageElementx
candidate recommendation initial definition.
SVGImageElement.y - Web APIs
WebAPISVGImageElementy
candidate recommendation initial definition.
SVGImageElement - Web APIs
candidate recommendation changed the inheritance from svgelement to svggraphicselement, removed the implemented interfaces svgtests, svglangspace, svgexternalresourcesrequired, svgstylable, and svgtransformable and added the crossorigin property.
SVGLineElement - Web APIs
candidate recommendation changed the inheritance from svgelement to svggeometryelement and removed the implemented interfaces svgtests, svglangspace, svgexternalresourcesrequired, svgstylable, and svgtransformable.
SVGLinearGradientElement - Web APIs
candidate recommendation no change scalable vector graphics (svg) 1.1 (second edition)the definition of 'svglineargradientelement' in that specification.
SVGMaskElement - Web APIs
candidate recommendation removed the implemented interfaces svgtests, svglangspace, svgexternalresourcesrequired, svgstylable, and svgtransformable.
SVGMetadataElement - Web APIs
candidate recommendation no change scalable vector graphics (svg) 1.1 (second edition)the definition of 'svgmetadataelement' in that specification.
SVGNumber - Web APIs
WebAPISVGNumber
candidate recommendation no change scalable vector graphics (svg) 1.1 (second edition)the definition of 'svgnumber' in that specification.
SVGPathElement - Web APIs
candidate recommendation removed the getpathsegatlength() and createsvgpathseg* methods and moved the pathlength property and the gettotallength() and getpointatlength() methods to svggeometryelement.
SVGPatternElement - Web APIs
candidate recommendation removed the implemented interfaces svgtests, svglangspace, svgexternalresourcesrequired, svgstylable, and svgtransformable.
SVGPolygonElement - Web APIs
candidate recommendation replaced the inheritance from svgelementsvgtests, svglangspace, svgexternalresourcesrequired, svgstylable, and svgtransformable by svggeometryelement scalable vector graphics (svg) 1.1 (second edition)the definition of 'svgpolygonelement' in that specification.
SVGPolylineElement - Web APIs
candidate recommendation replaced the inheritance from svgelementsvgtests, svglangspace, svgexternalresourcesrequired, svgstylable, and svgtransformable by svggeometryelement scalable vector graphics (svg) 1.1 (second edition)the definition of 'svgpolylineelement' in that specification.
SVGRadialGradientElement - Web APIs
candidate recommendation no change scalable vector graphics (svg) 1.1 (second edition)the definition of 'svgradialgradientelement' in that specification.
SVGRect - Web APIs
WebAPISVGRect
candidate recommendation changed svgrect as a legacy alias of domrect.
SVGRectElement - Web APIs
candidate recommendation replaced the inheritance from svgelementsvgtests, svglangspace, svgexternalresourcesrequired, svgstylable, and svgtransformable by svggeometryelement scalable vector graphics (svg) 1.1 (second edition)the definition of 'svgrectelement' in that specification.
SVGScriptElement - Web APIs
candidate recommendation removed the implemented interface svgexternalresourcesrequired and added the crossorigin property.
SVGStopElement - Web APIs
candidate recommendation removed inheritance from svgstylable.
SVGStyleElement - Web APIs
candidate recommendation added inheritance of linkstyle.
SVGSwitchElement - Web APIs
candidate recommendation changed the inheritance from svgelement to svggraphicselement and removed the implemented interfaces svgtests, svglangspace, svgexternalresourcesrequired, svgstylable, and svgtransformable.
SVGSymbolElement - Web APIs
candidate recommendation changed the inheritance from svgelement to svggraphicselement and removed the implemented interfaces svglangspace, svgexternalresourcesrequired, and svgstylable.
SVGTSpanElement - Web APIs
candidate recommendation no changes scalable vector graphics (svg) 1.1 (second edition)the definition of 'svgtspanelement' in that specification.
SVGTests - Web APIs
WebAPISVGTests
candidate recommendation removed requiredfeatures property and hasextension() method.
SVGTextContentElement - Web APIs
candidate recommendation changed inheritance from svgelement to svggraphicselement and getstartpositionofchar() and removed implementations of svgtests, svglangspace, svgexternalresourcesrequired, svgstylable interfaces and getendpositionofchar() to return a dompoint instead of an svgpoint.
SVGTextElement - Web APIs
candidate recommendation removed the implemented interface svgtransformable.
SVGTextPathElement - Web APIs
candidate recommendation no change scalable vector graphics (svg) 1.1 (second edition)the definition of 'svgtextpathelement' in that specification.
SVGTextPositioningElement - Web APIs
candidate recommendation no change scalable vector graphics (svg) 1.1 (second edition)the definition of 'svgtextpositioningelement' in that specification.
SVGTitleElement - Web APIs
candidate recommendation removed inheritance from svglangspace and svgstylable.
SVGURIReference - Web APIs
candidate recommendation replaced the deprecated xlink:href attribute reference by the href attribute and made the prior only be reflected where it's defined to be supported.
SVGUnitTypes - Web APIs
candidate recommendation no change scalable vector graphics (svg) 1.1 (second edition)the definition of 'svgunittypes' in that specification.
SVGUseElement - Web APIs
candidate recommendation redefined the properties instanceroot and animatedinstanceroot.
SVGViewElement - Web APIs
candidate recommendation removed a mixin svgexternalresourcesrequired scalable vector graphics (svg) 1.1 (second edition)the definition of 'svgviewelement' in that specification.
Selection API - Web APIs
editor's draft initial (older) definition, which is now outdated.
Sensor.activated - Web APIs
WebAPISensoractivated
candidate recommendation initial definition.
Sensor.hasReading - Web APIs
WebAPISensorhasReading
candidate recommendation initial definition.
Sensor.onactivate - Web APIs
WebAPISensoronactivate
candidate recommendation initial definition.
Sensor.onerror - Web APIs
WebAPISensoronerror
candidate recommendation initial definition.
Sensor.onreading - Web APIs
WebAPISensoronreading
candidate recommendation initial definition.
Sensor.start() - Web APIs
WebAPISensorstart
candidate recommendation initial definition.
Sensor.stop() - Web APIs
WebAPISensorstop
candidate recommendation initial definition.
Sensor.timestamp - Web APIs
WebAPISensortimestamp
candidate recommendation initial definition.
Sensor - Web APIs
WebAPISensor
candidate recommendation initial definition.
SensorErrorEvent.SensorErrorEvent() - Web APIs
candidate recommendation initial definition.
SensorErrorEvent.error - Web APIs
candidate recommendation initial definition.
SensorErrorEvent - Web APIs
candidate recommendation initial definition.
ServiceWorkerContainer.register() - Web APIs
the register() method of the serviceworkercontainer interface creates or updates a serviceworkerregistration for the given scripturl.
ServiceWorkerGlobalScope.onpushsubscriptionchange - Web APIs
previously, it was defined as the event interface that is fired whenever a push subscription has been invalidated (or is about to become so).
ServiceWorkerGlobalScope.skipWaiting() - Web APIs
use this method with clients.claim() to ensure that updates to the underlying service worker take effect immediately for both the current client and all other active clients.
ServiceWorkerGlobalScope - Web APIs
pushsubscriptionchange occurs when a push subscription has been invalidated, or is about to be invalidated (e.g.
ServiceWorkerRegistration.showNotification() - Web APIs
on android devices, the badge should accommodate devices up to 4x resolution, about 96 by 96 px, and the image will be automatically masked.
SourceBuffer.appendWindowEnd - Web APIs
invalidstateerror this sourcebuffer object is being updated (i.e.
SourceBuffer.appendWindowStart - Web APIs
invalidstateerror this sourcebuffer object is being updated (i.e.
SourceBuffer.mode - Web APIs
WebAPISourceBuffermode
invalidstateerror the sourcebuffer object is being updated (i.e.
SourceBuffer.timestampOffset - Web APIs
exception explanation invalidstateerror one or more of the sourcebuffer objects in mediasource.sourcebuffers are being updated (i.e.
SourceBuffer.trackDefaults - Web APIs
exception explanation invalidstateerror one or more of the sourcebuffer objects in mediasource.sourcebuffers are being updated (i.e.
SourceBuffer.updating - Web APIs
the updating read-only property of the sourcebuffer interface indicates whether the sourcebuffer is currently being updated — i.e.
SpeechRecognitionResult.isFinal - Web APIs
the isfinal read-only property of the speechrecognitionresult interface is a boolean that states whether this result is final (true) or not (false) — if so, then this is the final time this result will be returned; if not, then this result is an interim result, and may be updated later on.
SpeechRecognitionResult - Web APIs
properties speechrecognitionresult.isfinal read only a boolean that states whether this result is final (true) or not (false) — if so, then this is the final time this result will be returned; if not, then this result is an interim result, and may be updated later on.
StaticRange - Web APIs
the dom staticrange interface extends abstractrange to provide a method to specify a range of content in the dom whose contents don't update to reflect changes which occur within the dom tree.
StereoPannerNode.pan - Web APIs
we then use an oninput event handler to change the value of the stereopannernode.pan parameter and update the pan value display when the slider is moved.
StereoPannerNode - Web APIs
we then use an oninput event handler to change the value of the stereopannernode.pan parameter and update the pan value display when the slider is moved.
TextTrackList.onchange - Web APIs
syntax texttracklist.onchange = eventhandler; example this snippet establishes a handler for the change event that looks at each of the tracks in the list, calling a function to update the state of a user interface control that indicates the current state of the track.
Using Touch Events - Web APIs
the target touch element or node should be large enough to accommodate a finger touch.
UIEvent.pageX - Web APIs
WebAPIUIEventpageX
do not look for pagex on any non-mouse events in new code and update existing code as soon as possible.
ULongRange - Web APIs
candidate recommendation initial definition ...
URL.createObjectURL() - Web APIs
important: if you still have code that relies on createobjecturl() to attach streams to media elements, you need to update your code to simply set srcobject to the mediastream directly.
URL API - Web APIs
WebAPIURL API
for example, to create a url and set its username: let myusername = "someguy"; let addr = new url("https://mysite.com/login"); addr.username = myusername; setting the value of username not only sets that property's value, but it updates the overall url.
USBEndpoint - Web APIs
this code identifies the correct endpoints by searching for the interface implementing the usb cdc interface class and then identifying the candidate endpoints based on their type and direction.
USVString - Web APIs
WebAPIUSVString
candidate recommendation initial definition.
VTTCue() - Web APIs
WebAPIVTTCueVTTCue
candidate recommendation ...
VTTCue - Web APIs
WebAPIVTTCue
specifications specification status comment webvtt: the web video text tracks format candidate recommendation ...
VTTRegion - Web APIs
WebAPIVTTRegion
specifications specification status comment webvtt: the web video text tracks format candidate recommendation ...
ValidityState.rangeOverflow - Web APIs
if the field is numeric in nature, including the date, month, week, time, datetime-local, number and range types and a max value is set, if the value don't doesn't conform to the constraints set by the max value, the rangeoverflow property will be true.
ValidityState.rangeUnderflow - Web APIs
if the field is numeric in nature, including the date, month, week, time, datetime-local, number and range types and a min value is set, if the value don't doesn't conform to the constraints set by the min value, the rangeunderflow property will be true.
ValidityState.stepMismatch - Web APIs
if the field is numeric in nature, including the date, month, week, time, datetime-local, number and range types and the step value is not any, if the value don't doesn't conform to the constraints set by the step and min values, then stepmismatch will be true.
ValidityState - Web APIs
together, they help explain why an element's value fails to validate, if it's not valid.
VideoPlaybackQuality.creationTime - Web APIs
if that exceeds 10% (0.1), a function called lostframesthresholdexceeded() is called to, perhaps, update a quality indicator to show an increase in frame loss.
VideoPlaybackQuality.totalVideoFrames - Web APIs
if that exceeds 10% (0.1), a function called lostframesthresholdexceeded() is called to, perhaps, update a quality indicator to show an increase in frame loss.
WebGL2RenderingContext.texImage3D() - Web APIs
editor's draft updated definition for webgl.
WebGL2RenderingContext.vertexAttribDivisor() - Web APIs
divisor a gluint specifying the number of instances that will pass between updates of the generic attribute.
WebGLRenderingContext.bindBuffer() - Web APIs
editor's draft updated definition for webgl 2.
WebGLRenderingContext.bindFramebuffer() - Web APIs
editor's draft updated definition for webgl 2.
WebGLRenderingContext.bindTexture() - Web APIs
editor's draft updated definition for webgl 2.
WebGLRenderingContext.bufferSubData() - Web APIs
the webglrenderingcontext.buffersubdata() method of the webgl api updates a subset of a buffer object's data store.
WebGLRenderingContext.checkFramebufferStatus() - Web APIs
editor's draft updated definition for webgl 2.
WebGLRenderingContext.cullFace() - Web APIs
syntax void gl.cullface(mode); parameters mode a glenum specifying whether front- or back-facing polygons are candidates for culling.
WebGLRenderingContext.getBufferParameter() - Web APIs
editor's draft updated definition for webgl.
WebGLRenderingContext.getFramebufferAttachmentParameter() - Web APIs
editor's draft updated definition for webgl 2.
WebGLRenderingContext.getProgramParameter() - Web APIs
gl.validate_status: returns a glboolean indicating whether or not the last validation operation was successful.
WebGLRenderingContext.getRenderbufferParameter() - Web APIs
editor's draft updated definition for webgl 2.
WebGLRenderingContext.getTexParameter() - Web APIs
editor's draft updated definition for webgl.
WebGLRenderingContext.getUniform() - Web APIs
editor's draft updated definition for webgl.
WebGLRenderingContext.getVertexAttrib() - Web APIs
editor's draft updated definition for webgl 2.
WebGLRenderingContext.isContextLost() - Web APIs
the user updates their graphics driver on an operating system that allows graphics drivers to be updated without restarting the system.
WebGLRenderingContext.pixelStorei() - Web APIs
editor's draft updated definition for webgl 2.
WebGLRenderingContext.renderbufferStorage() - Web APIs
editor's draft updated definition for webgl 2.
WebGLRenderingContext.stencilFuncSeparate() - Web APIs
syntax void gl.stencilfuncseparate(face, func, ref, mask); parameters face a glenum specifying whether the front and/or back stencil state is updated.
WebGLRenderingContext.stencilMaskSeparate() - Web APIs
syntax void gl.stencilmaskseparate(face, mask); parameters face a glenum specifying whether the front and/or back stencil writemask is updated.
WebGLRenderingContext.stencilOpSeparate() - Web APIs
face a glenum specifying whether the front and/or back stencil state is updated.
WebGLRenderingContext.texImage2D() - Web APIs
editor's draft updated definition for webgl.
WebGLRenderingContext.texParameter[fi]() - Web APIs
editor's draft updated definition for webgl.
WebGLRenderingContext.texSubImage2D() - Web APIs
editor's draft updated definition for webgl.
Color masking - Web APIs
so, by masking off the blue and green channels, you are only allowing the red component of pixels to be updated, and therefore it is as if you were looking through a red tinted glass.
WebGL constants - Web APIs
validate_status 0x8b83 passed to getprogramparameter after calling validateprogram to determine if it is valid.
Creating 3D objects using WebGL - Web APIs
, 1.0, 1.0, 1.0, 1.0, 1.0, -1.0, // bottom face -1.0, -1.0, -1.0, 1.0, -1.0, -1.0, 1.0, -1.0, 1.0, -1.0, -1.0, 1.0, // right face 1.0, -1.0, -1.0, 1.0, 1.0, -1.0, 1.0, 1.0, 1.0, 1.0, -1.0, 1.0, // left face -1.0, -1.0, -1.0, -1.0, -1.0, 1.0, -1.0, 1.0, 1.0, -1.0, 1.0, -1.0, ]; since we've added a z-component to our vertices, we need to update the numcomponents of our vertexposition attribute to 3.
Using shaders to apply color in WebGL - Web APIs
to use these colors, the vertex shader needs to be updated to pull the appropriate color from the color buffer: const vssource = ` attribute vec4 avertexposition; attribute vec4 avertexcolor; uniform mat4 umodelviewmatrix; uniform mat4 uprojectionmatrix; varying lowp vec4 vcolor; void main(void) { gl_position = uprojectionmatrix * umodelviewmatrix * avertexposition; vcolor = avertexcolor; } `; the key di...
WebGL: 2D and 3D graphics for the web - Web APIs
WebAPIWebGL API
gl_compressed_texture_etc1 webgl_compressed_texture_pvrtc webgl_compressed_texture_s3tc webgl_compressed_texture_s3tc_srgb webgl_debug_renderer_info webgl_debug_shaders webgl_depth_texture webgl_draw_buffers webgl_lose_context events webglcontextlost webglcontextrestored webglcontextcreationerror constants and types webgl constants webgl types webgl 2 webgl 2 is a major update to webgl which is provided through the webgl2renderingcontext interface.
WebKitCSSMatrix - Web APIs
candidate recommendation ...
Introduction to the Real-time Transport Protocol (RTP) - Web APIs
it can be used for any form of continuous or active data transfer, including data streaming, active badges or status display updates, or control and measurement information transport.
Using WebRTC data channels - Web APIs
he goes into a bit more detail there, but as browsers have been updated since then some of it may be out-of-date.
WebSocket: close event - Web APIs
bubbles no cancelable no interface closeevent event handler property onclose examples you might want to know when the connection has been closed so that you can update the ui or, perhaps, save data about the closed connection.
The WebSocket API (WebSockets) - Web APIs
living standard websockets candidate recommendation rfc 6455: the websocket protocol ietf rfc ...
Web Video Text Tracks Format (WebVTT) - Web APIs
specifications specification status comment webvtt: the web video text tracks format candidate recommendation initial definition ...
Fundamentals of WebXR - Web APIs
this includes both managing the process of rendering the views needed to simulate the 3d experience and the ability to sense the movement of the headset or other motion sensing apparatus to provide the needed data to let you update the imagery shown to the user based on that movement.
Geometry and reference spaces in WebXR - Web APIs
the viewer isn't tracked at all; tracking is optimized for stability around the user's current position, so the native origin may drift as needed to accommodate that need.
WebXR performance guide - Web APIs
// apply rotation updates to the object if needed mat4.rotate( } } this renders a scene.
Rendering and the WebXR frame animation callback - Web APIs
two of the most common are handling of user inputs and performing updates to the positions of objects (or the viewer) based on known factors, such as those user control states or known animation paths of the objects in the scene.
Spaces and reference spaces: Spatial tracking in WebXR - Web APIs
werpose) { previousviewerpose = viewerpose; } let offsetmatrix = mat4.create(); mat4.sub(offsetmatrix, previousviewerpose.transform.matrix, viewerpose.transform.matrix); previousviewerpose = viewerpose; } } continuity and recovery after tracking loss sometimes, while the user is actively using their xr hardware with your app, the flow of data containing updates as to the user's position and orientation might be lost for a period of time.
Example and tutorial: Simple synth keyboard - Web APIs
this will simply update the master gain node's volume to the new value of the control.
Visualizations with Web Audio API - Web APIs
} x += slicewidth; } finally, we finish the line in the middle of the right hand side of the canvas, then draw the stroke we've defined: canvasctx.lineto(canvas.width, canvas.height/2); canvasctx.stroke(); }; at the end of this section of code, we invoke the draw() function to start off the whole process: draw(); this gives us a nice waveform display that updates several times a second: creating a frequency bar graph another nice little sound visualization to create is one of those winamp-style frequency bar graphs.
Web Audio API - Web APIs
this example makes use of the following web api interfaces: audiocontext, oscillatornode, periodicwave, and gainnode.migrating from webkitaudiocontextin this article, we cover the differences in web audio api since it was first implemented in webkit and how to update your code to use the modern web audio api.
Functions and classes available to Web Workers - Web APIs
fetch the fetch spec provides an up-to-date definition of, and api for, fetching resources (e.g.
The structured clone algorithm - Web APIs
boolean objects string objects date regexp lastindex is not preserved.
Web Workers API - Web APIs
they are intended, among other things, to enable the creation of effective offline experiences, intercept network requests and take appropriate action based on whether the network is available, and update assets residing on the server.
Window.controllers - Web APIs
chrome code can add controllers (to be used in conjunction with the godocommand and goupdatecommand functions in globaloverlay.js).
Window.frameElement - Web APIs
candidate recommendation initial specification.
Window.getComputedStyle() - Web APIs
the returned style is a live cssstyledeclaration object, which updates automatically when the element's styles are changed.
Window.isSecureContext - Web APIs
}); } specifications specification status comment secure contexts candidate recommendation initial definition.
Window.mozAnimationStartTime - Web APIs
this value should be used instead of, for example, date.now(), because this value will be the same for all animations started in this window during this refresh interval, allowing them to remain in sync with one another.
Window: popstate event - Web APIs
if new-entry has a different document object than current-entry, the browsing context is updated so that its document property refers to the document referred to by new-entry, and the context's name is updated to match the context name of the now-current document.
Window.screenLeft - Web APIs
WebAPIWindowscreenLeft
initialleft = window.screenleft + canvaselem.offsetleft; initialtop = window.screentop + canvaselem.offsettop; function positionelem() { let newleft = window.screenleft + canvaselem.offsetleft; let newtop = window.screentop + canvaselem.offsettop; let leftupdate = initialleft - newleft; let topupdate = initialtop - newtop; ctx.fillstyle = 'rgb(0, 0, 0)'; ctx.fillrect(0, 0, width, height); ctx.fillstyle = 'rgb(0, 0, 255)'; ctx.beginpath(); ctx.arc(leftupdate + (width/2), topupdate + (height/2) + 35, 50, degtorad(0), degtorad(360), false); ctx.fill(); pelem.textcontent = 'window.screenleft: ' + window.screenleft + ', window.screentop: ' +...
Window.screenTop - Web APIs
WebAPIWindowscreenTop
initialleft = window.screenleft + canvaselem.offsetleft; initialtop = window.screentop + canvaselem.offsettop; function positionelem() { let newleft = window.screenleft + canvaselem.offsetleft; let newtop = window.screentop + canvaselem.offsettop; let leftupdate = initialleft - newleft; let topupdate = initialtop - newtop; ctx.fillstyle = 'rgb(0, 0, 0)'; ctx.fillrect(0, 0, width, height); ctx.fillstyle = 'rgb(0, 0, 255)'; ctx.beginpath(); ctx.arc(leftupdate + (width/2), topupdate + (height/2) + 35, 50, degtorad(0), degtorad(360), false); ctx.fill(); pelem.textcontent = 'window.screenleft: ' + window.screenleft + ', window.screentop: ' +...
Window.screenX - Web APIs
WebAPIWindowscreenX
initialleft = window.screenleft + canvaselem.offsetleft; initialtop = window.screentop + canvaselem.offsettop; function positionelem() { let newleft = window.screenleft + canvaselem.offsetleft; let newtop = window.screentop + canvaselem.offsettop; let leftupdate = initialleft - newleft; let topupdate = initialtop - newtop; ctx.fillstyle = 'rgb(0, 0, 0)'; ctx.fillrect(0, 0, width, height); ctx.fillstyle = 'rgb(0, 0, 255)'; ctx.beginpath(); ctx.arc(leftupdate + (width/2), topupdate + (height/2) + 35, 50, degtorad(0), degtorad(360), false); ctx.fill(); pelem.textcontent = 'window.screenleft: ' + window.screenleft + ', window.screentop: ' +...
Window.screenY - Web APIs
WebAPIWindowscreenY
initialleft = window.screenleft + canvaselem.offsetleft; initialtop = window.screentop + canvaselem.offsettop; function positionelem() { let newleft = window.screenleft + canvaselem.offsetleft; let newtop = window.screentop + canvaselem.offsettop; let leftupdate = initialleft - newleft; let topupdate = initialtop - newtop; ctx.fillstyle = 'rgb(0, 0, 0)'; ctx.fillrect(0, 0, width, height); ctx.fillstyle = 'rgb(0, 0, 255)'; ctx.beginpath(); ctx.arc(leftupdate + (width/2), topupdate + (height/2) + 35, 50, degtorad(0), degtorad(360), false); ctx.fill(); pelem.textcontent = 'window.screenleft: ' + window.screenleft + ', window.screentop: ' +...
Window.setImmediate() - Web APIs
this method is used to break up long running operations and run a callback function immediately after the browser has completed other operations such as events and display updates.
Window - Web APIs
WebAPIWindow
window.updatecommands() updates the state of commands of the current chrome window (ui).
WindowEventHandlers.onbeforeunload - Web APIs
if you do so, javascript in the page will be triggered on the subsequent return visit and update the content as desired.
WindowEventHandlers.onlanguagechange - Web APIs
such an event is sent by the browser to inform that the preferred languages list has been updated.
WindowOrWorkerGlobalScope.isSecureContext - Web APIs
candidate recommendation initial definition.
WorkerGlobalScope.self - Web APIs
observe: function observe() { [native code] } prototype: array[0] unobserve: function unobserve() { [native code] } __proto__: function empty() {} <function scope> arraybuffer: function arraybuffer() { [native code] } blob: function blob() { [native code] } boolean: function boolean() { [native code] } dataview: function dataview() { [native code] } date: function date() { [native code] } dedicatedworkerglobalscope: function dedicatedworkerglobalscope() { [native code] } error: function error() { [native code] } // etc.
WorkerNavigator.permissions - Web APIs
the workernavigator.permissions read-only property returns a permissions object that can be used to query and update permission status of apis covered by the permissions api.
WorkerNavigator - Web APIs
workernavigator.permissions read only returns a permissions object that can be used to query and update permission status of apis covered by the permissions api.
XMLHttpRequest.getAllResponseHeaders() - Web APIs
an example of what a raw header string looks like: date: fri, 08 dec 2017 21:04:30 gmt\r\n content-encoding: gzip\r\n x-content-type-options: nosniff\r\n server: meinheld/0.6.1\r\n x-frame-options: deny\r\n content-type: text/html; charset=utf-8\r\n connection: keep-alive\r\n strict-transport-security: max-age=63072000\r\n vary: cookie, accept-encoding\r\n content-length: 6502\r\n x-xss-protection: 1; mode=block\r\n each line is terminated by both ca...
XMLHttpRequest - Web APIs
this enables a web page to update just part of a page without disrupting what the user is doing.
XPathResult.invalidIteratorState - Web APIs
html <div>xpath example</div> <p>iterator state: <output></output></p> javascript var xpath = "//div"; var result = document.evaluate(xpath, document, null, xpathresult.any_type, null); // invalidates the iterator state document.queryselector("div").remove(); document.queryselector("output").textcontent = result.invaliditeratorstate ?
XRHandedness - Web APIs
function updateinputsources(session, frame, refspace) { for (let source of session.inputsources) { if (source.gripspace) { let grippose = frame.getpose(source.gripspace, refspace); if (grippose) { myrenderhandobject(grippose, inputsource.handedness); } } } } this function, which would be called every animation frame (or possibly just periodically, depending on the degree ...
XRInputSource.handedness - Web APIs
function updateinputsources(session, frame, refspace) { for (let source of session.inputsources) { if (source.gripspace) { let grippose = frame.getpose(source.gripspace, refspace); if (grippose) { myrenderhandobject(grippose, inputsource.handedness); } } } } this function, which would be called every animation frame (or possibly just periodically, depending on the degree ...
XRInputSource.targetRayMode - Web APIs
function updateinputsources(session, frame, refspace) { for (let source of session.getinputsources()) { let targetraypose = frame.getpose(inputsource.targetrayspace, refspace); if (targetraypose) { if (source.targetraymode == "tracked-pointer") { myrendertargetrayasbeam(targetraypose); } } /* ...
XRInputSource.targetRaySpace - Web APIs
function updateinputsources(session, frame, refspace) { for (let source of session.getinputsources()) { let targetraypose = frame.getpose(inputsource.targetrayspace, refspace); if (targetraypose) { if (source.targetraymode == "tracked-pointer") { myrendertargetrayasbeam(targetraypose); } } /* ...
XRInputSourcesChangeEvent() - Web APIs
the xrinputsourceschangeevent() constructor creates and returns a new xrinputsourceschangeevent object, representing an update to the list of available webxr input devices.
XRPermissionDescriptor.optionalFeatures - Web APIs
the viewer isn't tracked at all; tracking is optimized for stability around the user's current position, so the native origin may drift as needed to accommodate that need.
XRPermissionDescriptor.requiredFeatures - Web APIs
the viewer isn't tracked at all; tracking is optimized for stability around the user's current position, so the native origin may drift as needed to accommodate that need.
XRPermissionStatus.granted - Web APIs
the viewer isn't tracked at all; tracking is optimized for stability around the user's current position, so the native origin may drift as needed to accommodate that need.
XRPose - Web APIs
WebAPIXRPose
this is obtained using xrframe.getviewerpose() instead of getpose(), specifying a reference space which has been adjusted to position and orient the node to provide the desired viewing position and angle: viewerpose = xrframe.getviewerpose(adjreferencespace); here, adjreferencespace is a reference space which has been updated using the base frame of reference for the frame and any adjustments needed to position the viewer based on movement or rotation which is being supplied from a source other than the xr device, such as keyboard or mouse inputs.
XRReferenceSpace - Web APIs
the viewer isn't tracked at all; tracking is optimized for stability around the user's current position, so the native origin may drift as needed to accommodate that need.
XRReferenceSpaceEvent.transform - Web APIs
usage notes upon receiving a reset event, you can apply the transform to cached position or orientation information to shift them into the updated coordinate system.
XRReferenceSpaceEvent - Web APIs
this is an opportunity for your app to update any stored transforms, position/orientation information, or the like—or to dump any cached values based on the reference's space's origin so you can recompute them as needed.
XRReferenceSpaceType - Web APIs
the viewer isn't tracked at all; tracking is optimized for stability around the user's current position, so the native origin may drift as needed to accommodate that need.
XRRenderState - Web APIs
when you apply changes using the xrsession method updaterenderstate(), the specified changes take effect after the current animation frame has completed, but before the next one begins.
XRRigidTransform.position - Web APIs
example to create a reference space which can be used to place an object at eye level (assuming eye level is 1.5 meters): function onsessionstarted(xrsession) { xrsession.addeventlistener("end", onsessionended); gl = initgraphics(xrsession); let gllayer = new xrwebgllayer(xrsession, gl); xrsession.updaterenderstate({ baselayer: gllayer }); if (immersivesession) { xrsession.requestreferencespace("bounded-floor").then((refspace) => { refspacecreated(refspace); }).catch(() => { session.requestreferencespace("local-floor").then(refspacecreated); }); } else { session.requestreferencespace("viewer").then(refspacecreated); } } function refspacecreated(refspace) { if...
XRSession.cancelAnimationFrame() - Web APIs
const xr = navigator.xr; let requesthandle = null; let xrsession = null; if (xr) { xr.issessionsupported('immersive-vr') .then((issupported) => { if (issupported) { startxr(); } }); } function framecallback(time, xrframe) { xrsession.requestanimationframe(framecallback); // update and render the frame } async function startxr() { xrsession = xr.requestsession("immersive-vr"); if (xrsession) { stopbutton.onclick = stopxr; requesthandle = xrsession.requestanimationframe(framecallback); } } function pausexr() { if (xrsession && requesthandle) { xrsession.cancelanimationframe(requesthandle); requesthandle = null; } } specifications spe...
XRSession.end() - Web APIs
WebAPIXRSessionend
you can use the promise to do things like update ui elements to reflect the shut down connection, trigger application shut down, or whatever else you might need to do.
XRSession.inputSources - Web APIs
the returned object is live; as devices are connected to and removed from the user's system, the list's contents update to reflect the changes.
XRSession.oninputsourceschange - Web APIs
note: the xrinputsource objects in xrsession.inputsources array are "live", so values within them are updated in-place.
XRSession.renderState - Web APIs
while this property is read only, you can call the xrsession method updaterenderstate() to make changes.
XRSession.requestReferenceSpace() - Web APIs
the viewer isn't tracked at all; tracking is optimized for stability around the user's current position, so the native origin may drift as needed to accommodate that need.
XRSession - Web APIs
WebAPIXRSession
updaterenderstate() updates the properties of the session's render state to match the values specified in the specified xrrenderstateinit dictionary.
XRTargetRayMode - Web APIs
function updateinputsources(session, frame, refspace) { for (let source of session.getinputsources()) { let targetraypose = frame.getpose(inputsource.targetrayspace, refspace); if (targetraypose) { if (source.targetraymode == "tracked-pointer") { myrendertargetrayasbeam(targetraypose); } } /* ...
XRWebGLLayer - Web APIs
although xrwebgllayer is currently the only type of framebuffer layer supported by webgl, it's entirely possible that future updates to the webxr specification may allow for other layer types and corresponding image sources.
XRWebGLLayerInit.alpha - Web APIs
xrsession.updaterenderstate({ baselayer: new xrwebgllayer(xrsession, gl, { alpha: false }); }); specifications specification status comment webxr device apithe definition of 'xrwebgllayerinit.alpha' in that specification.
XRWebGLLayerInit.antialias - Web APIs
let options = { antialias: getpreferencevalue("antialiasing") }; let gllayer = new xrwebgllayer(xrsession, gl, options); if (gllayer) { xrsession.updaterenderstate({ baselayer: gllayer }); } offering the user features such as the ability to enable or disable things like anti-aliasing can provide them with optiions to try when your app isn't performing as well as they'd like.
XRWebGLLayerInit.depth - Web APIs
xrsession.updaterenderstate({ baselayer: new xrwebgllayer(xrsession, gl, { depth: false }); }); specifications specification status comment webxr device apithe definition of 'xrwebgllayerinit.depth' in that specification.
XRWebGLLayerInit.framebufferScaleFactor - Web APIs
xrsession.updaterenderstate({ baselayer: new xrwebgllayer(xrsession, gl, { framebufferscalefactor: 0.5 }); }); specifications specification status comment webxr device apithe definition of 'xrwebgllayerinit.framebufferscalefactor' in that specification.
XRWebGLLayerInit.ignoreDepthValues - Web APIs
xrsession.updaterenderstate({ baselayer: new xrwebgllayer(xrsession, gl, { alpha: false, ignoredepthvalues: true }); }); specifications specification status comment webxr device apithe definition of 'xrwebgllayerinit.ignoredepthvalues' in that specification.
XRWebGLLayerInit.stencil - Web APIs
xrsession.updaterenderstate({ baselayer: new xrwebgllayer(xrsession, gl, { stencil: false }); }); specifications specification status comment webxr device apithe definition of 'xrwebgllayerinit.stencil' in that specification.
XRWebGLLayerInit - Web APIs
const layeroptions = { ignoredepthvalues: true }; xrsession.updaterenderstate({ baselayer: new xrwebgllayer(xrsession, gl, layeroptions); }); specifications specification status comment webxr device apithe definition of 'xrwebgllayerinit' in that specification.
msCapsLockWarningOff - Web APIs
the mscapslockwarningoff read/write property turns automatic caps lock warning on or off for validated password input fields.
msRegionOverflow - Web APIs
in particular, in this last case, that means the region may have received no content from the named flow (for example if the region is too small to accommodate any content).
mssitemodejumplistitemremoved - Web APIs
syntax event property object.oncandidatewindowhide = handler; addeventlistener method object.addeventlistener("mssitemodejumplistitemremoved", handler, usecapture) general info synchronous no bubbles no cancelable no note this event is raised once for every item that has been removed since the last time mssitemodeshowjumplist was called.
ARIA guides - Accessibility
error handling in forms labeling widgets labeling composite widgets and regions managing focus in composite widgets (aria-activedescendant vs roving tabindex) using landmark roles handling dynamic updates & live regions virtual vs.
Using the aria-relevant attribute - Accessibility
aria-relevant is commonly used when a web page contains content that may be updated while viewing the page.
Using the aria-valuetext attribute - Accessibility
the application would programmatically update aria-valuetext depending on aria-valuenow.
Using the status role - Accessibility
<p role="status">your changes were automatically saved.</p> working examples: notes aria attributes used status related aria techniques alert role live region roles live region attributes compatibility the paciello group published some data on compatibility via their 2014 blog post: screen reader support for aria live regions tbd: add updated support information for common ua and at product combinations additional resources previous recommendations from wai-aria 1.0 (2014) for the status role ...
How to file ARIA-related bugs - Accessibility
here's where to file bugs: when finding a bug, please also update the relevant compatibility tables in the examples page.
ARIA: contentinfo role - Accessibility
<article> <h2>everyday pad thai</h2> <!-- article content --> <footer aria-label="everyday pad thai metadata"> <p>posted on <time datetime="2018-09-23 12:17">may 16</time> by <a href="#">lisa</a>.</p> </footer> </article> ...
ARIA: Mark role - Accessibility
<p>the last half of the song is a slow-rising crescendo that peaks at the <span role="mark" aria-details="thread-1">end of the guitar solo</span>, before fading away sharply.</p> <div role="comment" id="thread-1" data-author="chris"> <h3>chris said</h3> <p class="comment-text">i really think this moment could use more cowbell.</p> <p><time datetime="2019-03-30t19:29">march 30 2019, 19:29</time></p> </div> the related comment is marked up using an html structure wrapped with a <div> containing role="comment".
ARIA: Suggestion role - Accessibility
</p> <div id="comment-source">suggested by chris, <time datetime="2019-03-30t19:29">march 30 2019, 19:29</time></div> browsers tend to provide a default black strikethrough for deletions, and a black underline for insertions, but you’ll probably want to use accessibility concerns landmark roles are intended to be used sparingly, to identify larger overall sections of the document.
ARIA: textbox role - Accessibility
for example, in a combobox, focus may remain on the textbox while the value of aria-activedescendant on the textbox element refers to a descendant of a popup listbox that is controlled by the textbox.this attribute must be updated programmatically as the focus changes.
Alerts - Accessibility
this method takes three parameters: the id of the input that is to be validated, the term to search for to ensure validity, and the error message to be inserted into the alert.
overview - Accessibility
and states, from the yui blog enhancing the jquery ui tabs accordingly to wcag 2.0 and aria tab panel example here on codetalks lightbox wcag 2.0 and aria-conformant lightbox application http://majx-js.digissime.net/js/popin/ form validation wcag 2.0 and aria-conformant live form validation tables german tutorial on creating an accessible form simple grid example at codetalks date picker grid at codetalks wcag 2.0 and aria-conformant sortable tables ...
Cognitive accessibility - Accessibility
enable the user to postpone content updates by providing a way to request content updates rather than updating automatically.
Robust - Accessibility
use the w3c validator to validate your markup.
Custom properties (--*): CSS variables - CSS: Cascading Style Sheets
WebCSS--*
candidate recommendation initial definition.
-moz-user-input - CSS: Cascading Style Sheets
note: -moz-user-input was one of the proposals leading to the proposed css 3 user-input property, which has not yet reached candidate recommendation (call for implementations).
::cue-region - CSS: Cascading Style Sheets
candidate recommendation initial definition.
::cue - CSS: Cascading Style Sheets
WebCSS::cue
candidate recommendation initial definition.
::first-letter (:first-letter) - CSS: Cascading Style Sheets
candidate recommendation allows the use of text-shadow with ::first-letter.
::first-line (:first-line) - CSS: Cascading Style Sheets
candidate recommendation allows the use of text-shadow with ::first-letter.
::selection - CSS: Cascading Style Sheets
note: ::selection was in drafts of css selectors level 3, but it was removed in the candidate recommendation phase because its was under-specified (especially with nested elements) and interoperability wasn't achieved (based on discussion in the w3c style mailing list).
:valid - CSS: Cascading Style Sheets
WebCSS:valid
the :valid css pseudo-class represents any <input> or other <form> element whose contents validate successfully.
additive-symbols - CSS: Cascading Style Sheets
candidate recommendation initial definition.
fallback - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
negative - CSS: Cascading Style Sheets
candidate recommendation initial definition.
pad - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
prefix - CSS: Cascading Style Sheets
candidate recommendation initial definition.
range - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
speak-as - CSS: Cascading Style Sheets
candidate recommendation initial definition.
suffix - CSS: Cascading Style Sheets
candidate recommendation initial definition.
symbols - CSS: Cascading Style Sheets
candidate recommendation initial definition.
system - CSS: Cascading Style Sheets
candidate recommendation initial definition.
@counter-style - CSS: Cascading Style Sheets
candidate recommendation initial definition.
font-family - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
font-stretch - CSS: Cascading Style Sheets
candidate recommendation ...
font-style - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
font-weight - CSS: Cascading Style Sheets
candidate recommendation ...
src - CSS: Cascading Style Sheets
WebCSS@font-facesrc
candidate recommendation initial definition ...
unicode-range - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
@font-face - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
any-hover - CSS: Cascading Style Sheets
WebCSS@mediaany-hover
candidate recommendation initial definition.
any-pointer - CSS: Cascading Style Sheets
candidate recommendation initial definition.
aspect-ratio - CSS: Cascading Style Sheets
candidate recommendation no change.
color-gamut - CSS: Cascading Style Sheets
candidate recommendation initial definition.
color-index - CSS: Cascading Style Sheets
candidate recommendation the value can now be negative, in which case it computes to false.
color - CSS: Cascading Style Sheets
WebCSS@mediacolor
candidate recommendation the value can now be negative, in which case it computes to false.
device-aspect-ratio - CSS: Cascading Style Sheets
candidate recommendation deprecated in media queries level 4.
device-height - CSS: Cascading Style Sheets
candidate recommendation deprecated in media queries level 4.
device-width - CSS: Cascading Style Sheets
candidate recommendation deprecated in media queries level 4.
grid - CSS: Cascading Style Sheets
WebCSS@mediagrid
candidate recommendation no change.
height - CSS: Cascading Style Sheets
WebCSS@mediaheight
candidate recommendation the value can now be negative, in which case it computes to false.
hover - CSS: Cascading Style Sheets
WebCSS@mediahover
candidate recommendation initial definition.
monochrome - CSS: Cascading Style Sheets
WebCSS@mediamonochrome
candidate recommendation the value can now be negative, in which case it computes to false.
orientation - CSS: Cascading Style Sheets
candidate recommendation no change.
overflow-block - CSS: Cascading Style Sheets
candidate recommendation initial definition.
overflow-inline - CSS: Cascading Style Sheets
candidate recommendation initial definition.
pointer - CSS: Cascading Style Sheets
WebCSS@mediapointer
candidate recommendation initial definition.
scan - CSS: Cascading Style Sheets
WebCSS@mediascan
candidate recommendation no change.
width - CSS: Cascading Style Sheets
WebCSS@mediawidth
candidate recommendation the value can now be negative, in which case it computes to false.
@supports - CSS: Cascading Style Sheets
WebCSS@supports
candidate recommendation initial definition.
Using CSS animations - CSS: Cascading Style Sheets
letting the browser control the animation sequence lets the browser optimize performance and efficiency by, for example, reducing the update frequency of animations running in tabs that aren't currently visible.
CSS Backgrounds and Borders - CSS: Cascading Style Sheets
specifications specification status comment css backgrounds and borders module level 3 candidate recommendation css level 2 (revision 1) recommendation css level 1 recommendation ...
Box alignment in grid layout - CSS: Cascading Style Sheets
the updated properties have not yet been implemented in all browsers.
Box alignment in Multi-column Layout - CSS: Cascading Style Sheets
note: multi-column layout predates the box alignment specification.
Using feature queries - CSS: Cascading Style Sheets
all browsers support display, as display: block dates back to css1.
CSS Conditional Rules - CSS: Cascading Style Sheets
reference at-rules @document @media @supports @import specifications specification status comment css conditional rules module level 3 candidate recommendation initial definition ...
CSS Counter Styles - CSS: Cascading Style Sheets
specifications specification status comment css counter styles level 3 candidate recommendation initial definition.
CSS Display - CSS: Cascading Style Sheets
candidate recommendation added run-in, flow, flow-root, contents and multi-keyword values.
Typical use cases of Flexbox - CSS: Cascading Style Sheets
patterns like this can make it much easier to create a library of form elements for your design, which easily accommodate additional elements being added.
CSS Fonts - CSS: Cascading Style Sheets
WebCSSCSS Fonts
css fonts module level 3 candidate recommendation adds font-feature-settings (and related higher-level properties) css level 2 (revision 1) recommendation css level 1 recommendation initial definition ...
CSS Fragmentation - CSS: Cascading Style Sheets
reference box-decoration-break break-after break-before break-inside orphans widows specifications specification status comment css fragmentation module level 3 candidate recommendation initial definition.
Box alignment in CSS Grid Layout - CSS: Cascading Style Sheets
if we update align-content to space-between, you can see how the elements on our grid space out: * {box-sizing: border-box;} .wrapper { border: 2px solid #f76707; border-radius: 5px; background-color: #fff4e6; } .wrapper > div { border: 2px solid #ffa94d; border-radius: 5px; background-color: #ffd8a8; padding: 1em; color: #d9480f; } .wrapper { display: grid; grid-te...
CSS Grid Layout and Accessibility - CSS: Cascading Style Sheets
however the onus is on us as developers to remember to go back to our source and update it to maintain logical order.
CSS Grid Layout - CSS: Cascading Style Sheets
css grid layout candidate recommendation initial definition.
Consistent list indentation - CSS: Cascading Style Sheets
meyer, netscape communications last updated date: published 30 aug 2002 copyright information: copyright © 2001-2003 netscape.
CSS Masking - CSS: Cascading Style Sheets
perties clip clip-path clip-rule mask mask-border mask-border-mode mask-border-outset mask-border-repeat mask-border-slice mask-border-source mask-border-width mask-clip mask-composite mask-image mask-mode mask-origin mask-position mask-repeat mask-size mask-type specifications specification status comment css masking module level 1 candidate recommendation scalable vector graphics (svg) 1.1 (second edition)the definition of 'mask' in that specification.
CSS Paged Media - CSS: Cascading Style Sheets
WebCSSCSS Pages
reference css properties page-break-after page-break-before page-break-inside at-rules @page pseudo-classes :blank :first :left :right specifications specification status comment css paged media module level 3 working draft css fragmentation module level 3 candidate recommendation css level 2 (revision 1) recommendation ...
Understanding CSS z-index - CSS: Cascading Style Sheets
last updated date: july 9, 2005 author's note: thanks to wladimir palant and rod whiteley for the review.
Basic concepts of CSS Scroll Snap - CSS: Cascading Style Sheets
note: the scroll-snap-stop property is currently marked at risk in the current candidate recommendation spec, therefore it may be removed.
Browser compatibility and Scroll Snap - CSS: Cascading Style Sheets
if you have only used the old firefox implementation of the specification, with the properties that are detailed in scroll snap points, you should update your code to use the new specification.
CSS Scroll Snap - CSS: Cascading Style Sheets
rgin-right scroll-margin-bottom scroll-margin-left scroll-margin-inline scroll-margin-inline-start scroll-margin-inline-end scroll-margin-block scroll-margin-block-start scroll-margin-block-end guides basic concepts of css scroll snap browser compatibility and scroll snap specification specification status comment css scroll snap module level 1 candidate recommendation initial definition ...
CSS Shapes - CSS: Cascading Style Sheets
svg: shapes and arbitrarily-shaped ui components specifications specification status comment css shapes module level 1 candidate recommendation initial definition ...
CSS Text - CSS: Cascading Style Sheets
WebCSSCSS Text
reference properties hanging-punctuation hyphens letter-spacing line-break overflow-wrap tab-size text-align text-align-last text-indent text-justify text-size-adjust text-transform white-space word-break word-spacing specifications specification status comment css logical properties and values level 1 editor's draft updates some properties to be independent of the directionality of the text.
CSS Text Decoration - CSS: Cascading Style Sheets
above <em>and</em> below it.</p> <p class="thick">this text has a really thick purple underline in supporting browsers.</p> <p class="blink">this text might blink for you, depending on the browser you use.</p> specifications specification status comment css text decoration module level 4 working draft css text decoration module level 3 candidate recommendation css level 2 (revision 1) recommendation css level 1 recommendation initial definition ...
CSS data types - CSS: Cascading Style Sheets
WebCSSCSS Types
<position> <quote> <ratio> <resolution> <shape-box> <shape-radius> <string> <time> <time-percentage> <timing-function> <toggle-value> <transform-function> <type-or-unit> <url> <url-modifier> <zero> specifications specification status comment css values and units module level 4 editor's draft css values and units module level 3 candidate recommendation initial definition.
CSS Custom Properties for Cascading Variables - CSS: Cascading Style Sheets
css properties --* specifications specification status comment css custom properties for cascading variables module level 1 candidate recommendation initial definition ...
Compositing and Blending - CSS: Cascading Style Sheets
reference properties background-blend-mode isolation mix-blend-mode data types <blend-mode> specifications specification status comment compositing and blending level 1 candidate recommendation initial definition ...
Contribute a recipe - CSS: Cascading Style Sheets
it may see periodical improvements or updates, and may eventually even be cleaned up (and de-archived) for better uxp focus, but for now, it's a historical snapshot for reference, not a living website.
Using media queries - CSS: Cascading Style Sheets
update how frequently the output device can modify the appearance of content added in media queries level 4.
Media queries - CSS: Cascading Style Sheets
specifications specification status comment media queries level 5 editor's draft css conditional rules module level 3 candidate recommendation media queries level 4 candidate recommendation media queries recommendation css level 2 (revision 1) recommendation initial definition ...
CSS reference - CSS: Cascading Style Sheets
WebCSSReference
be aware that any syntax error in a rule definition invalidates the entire rule.
Selector list - CSS: Cascading Style Sheets
#main, .content, article { font-size: 1.1em; } selector list invalidation a downside to using selector lists is that the following aren't equivalent: h1 { font-family: sans-serif } h2:maybe-unsupported { font-family: sans-serif } h3 { font-family: sans-serif } h1, h2:maybe-unsupported, h3 { font-family: sans-serif } this is because a single unsupported selector in a selector list invalidates the whole rule.
Value definition syntax - CSS: Cascading Style Sheets
candidate recommendation adds the hash mark multiplier.
Visual formatting model - CSS: Cascading Style Sheets
in addition, some of the terminologies around the display have been updated and clarified in the years since css2.
align-content - CSS: Cascading Style Sheets
candidate recommendation initial definition initial valuenormalapplies tomulti-line flex containersinheritednocomputed valueas specifiedanimation typediscrete ...
<angle-percentage> - CSS: Cascading Style Sheets
candidate recommendation defines <angle-percentage>.
<angle> - CSS: Cascading Style Sheets
WebCSSangle
candidate recommendation initial definition.
attr() - CSS: Cascading Style Sheets
WebCSSattr
candidate recommendation added two optional parameters; can be used on all properties; may return values other than <string>.
background-attachment - CSS: Cascading Style Sheets
candidate recommendation the shorthand property has been extended to support multiple backgrounds and the local value.
background-blend-mode - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
background-clip - CSS: Cascading Style Sheets
candidate recommendation initial definition.
background-image - CSS: Cascading Style Sheets
candidate recommendation from css2 revision 1, the property has been extended to support multiple backgrounds and any <image> css data type.
background-origin - CSS: Cascading Style Sheets
candidate recommendation initial definition.
background-position - CSS: Cascading Style Sheets
candidate recommendation adds support for multiple backgrounds and the four-value syntax.
background-repeat - CSS: Cascading Style Sheets
candidate recommendation adds support for multiple background images, the two-value syntax allowing distinct repetition behavior for the horizontal and vertical directions, the space and round keywords, and for backgrounds on inline-level elements by precisely defining the background painting area.
background-size - CSS: Cascading Style Sheets
candidate recommendation initial definition.
background - CSS: Cascading Style Sheets
candidate recommendation the shorthand property has been extended to support multiple backgrounds and the new background-size, background-origin and background-clip properties.
<basic-shape> - CSS: Cascading Style Sheets
candidate recommendation initial definition.
<blend-mode> - CSS: Cascading Style Sheets
candidate recommendation initial definition.
border-bottom-color - CSS: Cascading Style Sheets
candidate recommendation no significant changes, though the transparent keyword, now included in <color> which has been extended, has been formally removed.
border-bottom-left-radius - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
border-bottom-right-radius - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
border-bottom-style - CSS: Cascading Style Sheets
candidate recommendation no significant change.
border-bottom-width - CSS: Cascading Style Sheets
candidate recommendation no significant change.
border-bottom - CSS: Cascading Style Sheets
candidate recommendation no direct changes, though the modification of values for the border-bottom-color do apply to it.
border-color - CSS: Cascading Style Sheets
candidate recommendation the transparent keyword has been removed as it is now a part of the <color> data type.
border-image-outset - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
border-image-repeat - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
border-image-slice - CSS: Cascading Style Sheets
candidate recommendation initial defintion ...
border-image-source - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
border-image-width - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
border-image - CSS: Cascading Style Sheets
candidate recommendation initial definition initial valueas each of the properties of the shorthand:border-image-source: noneborder-image-slice: 100%border-image-width: 1border-image-outset: 0border-image-repeat: stretchapplies toall elements, except internal table elements when border-collapse is collapse.
border-left-color - CSS: Cascading Style Sheets
candidate recommendation no significant changes, though the transparent keyword, now included in <color> which has been extended, has been formally removed.
border-left-style - CSS: Cascading Style Sheets
candidate recommendation no significant change.
border-left-width - CSS: Cascading Style Sheets
candidate recommendation no significant change.
border-left - CSS: Cascading Style Sheets
candidate recommendation no direct changes, though the modification of values for the border-left-color do apply to it.
border-radius - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
border-right-color - CSS: Cascading Style Sheets
candidate recommendation no significant changes, though the transparent keyword, now included in <color> which has been extended, has been formally removed.
border-right-style - CSS: Cascading Style Sheets
candidate recommendation no significant change.
border-right-width - CSS: Cascading Style Sheets
candidate recommendation no significant change.
border-right - CSS: Cascading Style Sheets
candidate recommendation no direct changes, though the modification of values for the border-right-color do apply to it.
border-style - CSS: Cascading Style Sheets
candidate recommendation no change.
border-top-color - CSS: Cascading Style Sheets
candidate recommendation no significant changes, though the transparent keyword, now included in <color> which has been extended, has been formally removed.
border-top-left-radius - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
border-top-right-radius - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
border-top-style - CSS: Cascading Style Sheets
candidate recommendation no significant change.
border-top-width - CSS: Cascading Style Sheets
candidate recommendation no significant change.
border-top - CSS: Cascading Style Sheets
candidate recommendation no direct changes, though the modification of values for the border-top-color do apply to it.
border-width - CSS: Cascading Style Sheets
candidate recommendation no direct change; the <length> css data type extension has an effect on this property.
border - CSS: Cascading Style Sheets
WebCSSborder
candidate recommendation removes specific support for transparent, as it is now a valid <color>; this has no practical impact.
box-decoration-break - CSS: Cascading Style Sheets
candidate recommendation initial definition.
box-lines - CSS: Cascading Style Sheets
WebCSSbox-lines
if a value of multiple is specified, however, then the box is allowed to expand to multiple lines (that is, multiple rows or columns) in order to accommodate all of its children.
box-shadow - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
break-after - CSS: Cascading Style Sheets
candidate recommendation adds the recto and verso keywords.
break-before - CSS: Cascading Style Sheets
candidate recommendation adds the recto and verso keywords.
break-inside - CSS: Cascading Style Sheets
candidate recommendation no change.
calc() - CSS: Cascading Style Sheets
WebCSScalc
candidate recommendation initial definition ...
clip-path - CSS: Cascading Style Sheets
WebCSSclip-path
candidate recommendation extends its application to html elements.
clip - CSS: Cascading Style Sheets
WebCSSclip
candidate recommendation deprecates clip property, suggests clip-path as replacement.
column-gap (grid-column-gap) - CSS: Cascading Style Sheets
candidate recommendation specifies how this property affects grid layouts css multi-column layout modulethe definition of 'column-gap' in that specification.
column-width - CSS: Cascading Style Sheets
candidate recommendation adds intrinsic sizes via the keywords min-content, max-content, fill-available, and fit-content.
cross-fade() - CSS: Cascading Style Sheets
omitting the comma or percent invalidates the value.
<dimension> - CSS: Cascading Style Sheets
WebCSSdimension
candidate recommendation adds ch, rem, vw, vw, vmin, vmax, q css level 2 (revision 1)the definition of '<dimension>' in that specification.
<display-box> - CSS: Cascading Style Sheets
candidate recommendation ...
<display-inside> - CSS: Cascading Style Sheets
candidate recommendation ...
<display-internal> - CSS: Cascading Style Sheets
candidate recommendation ...
<display-legacy> - CSS: Cascading Style Sheets
candidate recommendation ...
<display-listitem> - CSS: Cascading Style Sheets
candidate recommendation ...
<display-outside> - CSS: Cascading Style Sheets
candidate recommendation ...
element() - CSS: Cascading Style Sheets
WebCSSelement
this image is live, meaning that if the html element is changed, the css properties using the resulting value are automatically updated.
fit-content() - CSS: Cascading Style Sheets
candidate recommendation defines the function when used as a track size.
flex-basis - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
flex-direction - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
flex-flow - CSS: Cascading Style Sheets
WebCSSflex-flow
candidate recommendation initial definition ...
flex-grow - CSS: Cascading Style Sheets
WebCSSflex-grow
candidate recommendation initial definition ...
flex-shrink - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
flex-wrap - CSS: Cascading Style Sheets
WebCSSflex-wrap
candidate recommendation ...
flex - CSS: Cascading Style Sheets
WebCSSflex
candidate recommendation initial definition ...
<flex> - CSS: Cascading Style Sheets
candidate recommendation initial definition.
font-family - CSS: Cascading Style Sheets
candidate recommendation no significant change css level 2 (revision 1)the definition of 'font-family' in that specification.
font-feature-settings - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
font-size-adjust - CSS: Cascading Style Sheets
candidate recommendation initial definition the css property font-size-adjust was initially defined in css 2, but dropped in css 2.1.
font-stretch - CSS: Cascading Style Sheets
candidate recommendation initial definition.
font-synthesis - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
font-variant-caps - CSS: Cascading Style Sheets
candidate recommendation initial definition browser compatibility the compatibility table on this page is generated from structured data.
font-variant-east-asian - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
font-variant-ligatures - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
font-variant-numeric - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
font-variant-position - CSS: Cascading Style Sheets
candidate recommendation initial definition.
font-variant - CSS: Cascading Style Sheets
candidate recommendation made it a shorthand of the new font-variant-* properties.
font - CSS: Cascading Style Sheets
WebCSSfont
candidate recommendation added support for font-stretch values.
<frequency-percentage> - CSS: Cascading Style Sheets
candidate recommendation defines <frequency-percentage>.
<frequency> - CSS: Cascading Style Sheets
WebCSSfrequency
candidate recommendation initial definition.
<gradient> - CSS: Cascading Style Sheets
WebCSSgradient
candidate recommendation initial definition.
grid-area - CSS: Cascading Style Sheets
WebCSSgrid-area
candidate recommendation initial definition ...
grid-auto-columns - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
grid-auto-flow - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
grid-auto-rows - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
grid-column-end - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
grid-column-start - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
grid-column - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
grid-row-end - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
grid-row-start - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
grid-row - CSS: Cascading Style Sheets
WebCSSgrid-row
candidate recommendation initial definition ...
grid-template-areas - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
grid-template-columns - CSS: Cascading Style Sheets
candidate recommendation initial definition css grid layout module level 2the definition of 'subgrid' in that specification.
grid-template-rows - CSS: Cascading Style Sheets
candidate recommendation initial definition css grid layout module level 2the definition of 'subgrid' in that specification.
grid-template - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
grid - CSS: Cascading Style Sheets
WebCSSgrid
candidate recommendation initial definition ...
ident - CSS: Cascading Style Sheets
WebCSSident
candidate recommendation ...
image-orientation - CSS: Cascading Style Sheets
candidate recommendation initial definition.
image-rendering - CSS: Cascading Style Sheets
candidate recommendation initial definition.
<image> - CSS: Cascading Style Sheets
WebCSSimage
candidate recommendation initial definition.
image() - CSS: Cascading Style Sheets
the first two represent the x and y coordates for the starting point of the box that will be created.
<integer> - CSS: Cascading Style Sheets
WebCSSinteger
candidate recommendation no significant change.
isolation - CSS: Cascading Style Sheets
WebCSSisolation
candidate recommendation initial definition ...
justify-content - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
<length-percentage> - CSS: Cascading Style Sheets
candidate recommendation defines <length-percentage>.
<length> - CSS: Cascading Style Sheets
WebCSSlength
candidate recommendation adds the ch, rem, vw, vh, vmin, vmax, and q units.
line-break - CSS: Cascading Style Sheets
anywhere there is a soft wrap opportunity around every typographic character unit, including around any punctuation character or preserved white spaces, or in the middle of words, disregarding any prohibition against line breaks, even those introduced by characters with the gl, wj, or zwj character class or mandated by the word-break property.
linear-gradient() - CSS: Cascading Style Sheets
candidate recommendation initial definition.
list-style-type - CSS: Cascading Style Sheets
candidate recommendation redefines css2.1 counters.
margin-left - CSS: Cascading Style Sheets
candidate recommendation defines the behavior of margin-left on flex items.
margin-right - CSS: Cascading Style Sheets
candidate recommendation defines the behavior of margin-right on flex items.
mask-border-mode - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
mask-clip - CSS: Cascading Style Sheets
WebCSSmask-clip
candidate recommendation initial definition ...
mask-composite - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
mask-image - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
mask-mode - CSS: Cascading Style Sheets
WebCSSmask-mode
candidate recommendation initial definition ...
mask-origin - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
mask-position - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
mask-repeat - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
mask-size - CSS: Cascading Style Sheets
WebCSSmask-size
candidate recommendation initial definition ...
mask-type - CSS: Cascading Style Sheets
WebCSSmask-type
candidate recommendation initial definition.
mask - CSS: Cascading Style Sheets
WebCSSmask
candidate recommendation extends its usage to html elements.
min-width - CSS: Cascading Style Sheets
WebCSSmin-width
candidate recommendation adds the auto keyword and uses it as the initial value.
minmax() - CSS: Cascading Style Sheets
WebCSSminmax
candidate recommendation initial definition ...
mix-blend-mode - CSS: Cascading Style Sheets
candidate recommendation initial definition browser compatibility the compatibility table in this page is generated from structured data.
<number> - CSS: Cascading Style Sheets
WebCSSnumber
candidate recommendation no significant change.
object-fit - CSS: Cascading Style Sheets
candidate recommendation initial definition browser compatibility the compatibility table on this page is generated from structured data.
object-position - CSS: Cascading Style Sheets
candidate recommendation initial definition.
order - CSS: Cascading Style Sheets
WebCSSorder
candidate recommendation initial definition initial value0applies toflex items and absolutely-positioned flex container childreninheritednocomputed valueas specifiedanimation typean integer ...
orphans - CSS: Cascading Style Sheets
WebCSSorphans
candidate recommendation extends orphans to apply to any type of fragment, including pages, regions, or columns.
paint-order - CSS: Cascading Style Sheets
candidate recommendation initial definition.
<percentage> - CSS: Cascading Style Sheets
candidate recommendation no significant change from css level 2 (revision 1).
pointer-events - CSS: Cascading Style Sheets
candidate recommendation scalable vector graphics (svg) 1.1 (second edition)the definition of 'pointer-events' in that specification.
radial-gradient() - CSS: Cascading Style Sheets
candidate recommendation initial definition.
repeat() - CSS: Cascading Style Sheets
WebCSSrepeat
candidate recommendation initial definition ...
repeating-linear-gradient() - CSS: Cascading Style Sheets
candidate recommendation initial definition.
repeating-radial-gradient() - CSS: Cascading Style Sheets
candidate recommendation initial definition.
<resolution> - CSS: Cascading Style Sheets
candidate recommendation adds the dppx unit.
revert - CSS: Cascading Style Sheets
WebCSSrevert
candidate recommendation initial definition.
scroll-margin-block-end - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
scroll-margin-block-start - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
scroll-margin-block - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
scroll-margin-bottom - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
scroll-margin-inline-end - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
scroll-margin-inline-start - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
scroll-margin-inline - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
scroll-margin-left - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
scroll-margin-right - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
scroll-margin-top - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
scroll-margin - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
scroll-padding-block-end - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
scroll-padding-block-start - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
scroll-padding-block - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
scroll-padding-bottom - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
scroll-padding-inline-end - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
scroll-padding-inline-start - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
scroll-padding-inline - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
scroll-padding-left - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
scroll-padding-right - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
scroll-padding-top - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
scroll-padding - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
scroll-snap-align - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
scroll-snap-stop - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
scroll-snap-type - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
shape-image-threshold - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
shape-margin - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
shape-outside - CSS: Cascading Style Sheets
candidate recommendation initial definition.
<string> - CSS: Cascading Style Sheets
WebCSSstring
candidate recommendation no significant change from css level 2 (revision 1).
symbols() - CSS: Cascading Style Sheets
WebCSSsymbols
candidate recommendation initial defintion.
table-layout - CSS: Cascading Style Sheets
if the table layout were auto, the table would grow to accomodate its contents, despite the specified width.
text-combine-upright - CSS: Cascading Style Sheets
candidate recommendation add digits value css writing modes module level 3the definition of 'text-combine-upright' in that specification.
text-decoration-color - CSS: Cascading Style Sheets
candidate recommendation initial definition.
text-decoration-line - CSS: Cascading Style Sheets
candidate recommendation initial definition.
text-decoration-style - CSS: Cascading Style Sheets
candidate recommendation initial definition.
text-decoration-thickness - CSS: Cascading Style Sheets
note: the property used to be called text-decoration-width, but was updated in 2019 to text-decoration-thickness.
text-decoration - CSS: Cascading Style Sheets
candidate recommendation transformed into a shorthand property.
text-emphasis-color - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
text-emphasis-position - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
text-emphasis-style - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
text-emphasis - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
text-overflow - CSS: Cascading Style Sheets
working draft initial definition a previous version of this interface reached the candidate recommendation status.
text-rendering - CSS: Cascading Style Sheets
candidate recommendation no change scalable vector graphics (svg) 1.1 (second edition)the definition of 'text-rendering' in that specification.
text-shadow - CSS: Cascading Style Sheets
candidate recommendation the css property text-shadow was improperly defined in css2 and dropped in css2 (level 1).
text-underline-position - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
<time-percentage> - CSS: Cascading Style Sheets
candidate recommendation defines <time-percentage>.
<time> - CSS: Cascading Style Sheets
WebCSStime
candidate recommendation normative definition of s and ms.
url() - CSS: Cascading Style Sheets
WebCSSurl()
candidate recommendation no significant change from css level 2 (revision 1).
<url> - CSS: Cascading Style Sheets
WebCSSurl
candidate recommendation no significant change from css level 2 (revision 1).
var() - CSS: Cascading Style Sheets
WebCSSvar
candidate recommendation initial definition ...
visibility - CSS: Cascading Style Sheets
candidate recommendation defines the collapse value as it applies to flex items.
widows - CSS: Cascading Style Sheets
WebCSSwidows
candidate recommendation extends widows to apply to any type of fragment, including pages, regions, or columns.
will-change - CSS: Cascading Style Sheets
candidate recommendation initial definition ...
writing-mode - CSS: Cascading Style Sheets
candidate recommendation add sideways-lr and sideways-rl css writing modes module level 3the definition of 'writing-mode' in that specification.
Ajax - Developer guides
WebGuideAJAX
when these technologies are combined in the ajax model, web applications are able to make quick, incremental updates to the user interface without reloading the entire browser page.
Live streaming web audio and video - Developer guides
reference client dynamic streaming over http the state of mpeg-dash deployment look, no plugins: live streaming to the browser using media source extensions and mpeg-dash media source extensions (w3c) icecast shoutcast gstreamer streaming gstreamer pipelines via http streaming media using gstreamer on the web gstreamer and raspberry pi acceptance of media source extensions as w3c candidate recommendation will accelerate adoption of dash.js comparison of streaming media systems mozilla hacks - streaming media on demand with media source extensions ...
Writing Web Audio API code that works in every browser - Developer guides
there's a section in the spec that lists the old names and their updated equivalences; be sure to check it out and change your code accordingly.
Block formatting context - Developer guides
candidate recommendation define bfc(abbr) etc.
Media events - Developer guides
timeupdate the time indicated by the element's currenttime attribute has changed.
Introduction to Web development - Developer guides
javascript reference guide — a comprehensive, regularly updated guide to javascript for all levels of learning from beginner to advanced.
Separate sites for mobile and desktop - Developer guides
every time a new browser comes out, you must adjust your algorithm to accommodate it.
SVG-in-OpenType - Developer guides
once we're ready for wider adoption the information from wiki.mozilla.org will be moved here, updated and expanded.
Developer guides
ajax ajax is a term that defines a group of technologies allowing web applications to make quick, incremental updates to the user interface without reloading the entire browser page.
disabled - HTML: Hypertext Markup Language
constraint validation if the element is disabled, then the element's value can not receive focus and cannot be updated by the user, and does not participate in constraint validation.
HTML attribute: pattern - HTML: Hypertext Markup Language
specifying a pattern you can use the pattern attribute to specify a regular expression that the inputted value must match in order to be considered valid (see validating against a regular expression for a simple crash course on using regular expressions to validate inputs).
HTML attribute: required - HTML: Hypertext Markup Language
the required attribute is supported by text, search, url, tel, email, password, date, month, week, time, datetime-local, number, checkbox, radio, file, <input> types along with the <select> and <textarea> form control elements.
<a>: The Anchor element - HTML: Hypertext Markup Language
WebHTMLElementa
candidate recommendation added the referrerpolicy attribute.
<area> - HTML: Hypertext Markup Language
WebHTMLElementarea
candidate recommendation added the referrerpolicy attribute.
<bgsound>: The Background Sound element (obsolete) - HTML: Hypertext Markup Language
WebHTMLElementbgsound
you can write <bgsound> as a self-closing tag (<bgsound />); however, since this element is non-standard, doing so will still not validate.
<data> - HTML: Hypertext Markup Language
WebHTMLElementdata
if the content is time- or date-related, the <time> element must be used.
<header> - HTML: Hypertext Markup Language
WebHTMLElementheader
examples page header <header> <h1>main page title</h1> <img src="mdn-logo-sm.png" alt="mdn logo"> </header> article header <article> <header> <h2>the planet earth</h2> <p>posted on wednesday, <time datetime="2017-10-04">4 october 2017</time> by jane smith</p> </header> <p>we live on a planet that's blue and green, with so many things still unseen.</p> <p><a href="https://janesmith.com/the-planet-earth/">continue reading....</a></p> </article> specifications specification status comment html living standardthe definition of '<header>' in that specification.
<iframe>: The Inline Frame element - HTML: Hypertext Markup Language
WebHTMLElementiframe
candidate recommendation added the referrerpolicy attribute.
<input type="password"> - HTML: Hypertext Markup Language
WebHTMLElementinputpassword
with a pattern, you can mandate case rules, require the use of some number of digits and/or punctuation characters, and so forth.
<tbody>: The Table Body element - HTML: Hypertext Markup Language
WebHTMLElementtbody
let's take the previous example, add some more students to the list, and update the table so that instead of listing each student's major on every row, the students are grouped by major, with heading rows for each major.
<title>: The Document Title element - HTML: Hypertext Markup Language
WebHTMLElementtitle
example <title>menu - blue house chinese food - foodyum: online takeout today!</title> to help the user, update the page title value to reflect significant page state changes (such as form validation problems).
<track>: The Embed Text Track element - HTML: Hypertext Markup Language
WebHTMLElementtrack
for example the text at the beginning of the star wars films, or the date, time, and location of a scene.
HTML elements reference - HTML: Hypertext Markup Language
WebHTMLElement
if the content is time- or date-related, the <time> element must be used.
dir - HTML: Hypertext Markup Language
firefox uses ctrl/cmd + shift + x but does not update the dir attribute value.
title - HTML: Hypertext Markup Language
semantics, structure, and apis of html documents using the html title attribute – updated | the paciello group tooltips & toggletips - inclusive components the trials and tribulations of the title attribute - 24 accessibility specifications specification status comment html living standardthe definition of 'title' in that specification.
Global attributes - HTML: Hypertext Markup Language
d, onerror, onfocus, oninput, oninvalid, onkeydown, onkeypress, onkeyup, onload, onloadeddata, onloadedmetadata, onloadstart, onmousedown, onmouseenter, onmouseleave, onmousemove, onmouseout, onmouseover, onmouseup, onmousewheel, onpause, onplay, onplaying, onprogress, onratechange, onreset, onresize, onscroll, onseeked, onseeking, onselect, onshow, onsort, onstalled, onsubmit, onsuspend, ontimeupdate, ontoggle, onvolumechange, onwaiting.
Link types - HTML: Hypertext Markup Language
candidate recommendation added preload.
Preloading content with rel="preload" - HTML: Hypertext Markup Language
candidate recommendation further details of preload.
Quirks Mode and Standards Mode - HTML: Hypertext Markup Language
earlier versions of the html standard recommended other variants, but all existing browsers today will use full standards mode for this doctype, even the dated internet explorer 6.
Basics of HTTP - HTTP
on top of these basic concepts, numerous extensions have been developed over the years that add updated functionality and semantics with new http methods or headers.
Reason: CORS request external redirect not allowed - HTTP
to fix the problem, update your code to use the new url as reported by the redirect, thereby avoiding the redirect.
Reason: invalid token ‘xyz’ in CORS header ‘Access-Control-Allow-Headers’ - HTTP
it may also be worth checking to ensure that the user agent or http library you're using on the client is up-to-date.
Reason: invalid token ‘xyz’ in CORS header ‘Access-Control-Allow-Methods’ - HTTP
it may also be worth checking to ensure that the user agent or http library you're using on the client is up-to-date.
Reason: missing token ‘xyz’ in CORS header ‘Access-Control-Allow-Headers’ from CORS preflight channel - HTTP
to fix this, the server needs to be updated so that it allows the indicated header, or you need to avoid using that header.
Age - HTTP
WebHTTPHeadersAge
if it is age: 0, it was probably just fetched from the origin server; otherwise it is usually calculated as a difference between the proxy's current date and the date general header included in the http response.
Alt-Svc - HTTP
WebHTTPHeadersAlt-Svc
syntax alt-svc: clear alt-svc: <protocol-id>=<alt-authority>; ma=<max-age> alt-svc: <protocol-id>=<alt-authority>; ma=<max-age>; persist=1 clear the special value ''clear" indicates that the origin requests all alternatives for that origin to be invalidated.
CSP: block-all-mixed-content - HTTP
candidate recommendation initial definition.
CSP: upgrade-insecure-requests - HTTP
candidate recommendation initial definition.
Digest - HTTP
WebHTTPHeadersDigest
when released, the "resource digests for http" draft therefore will obsolete rfc 3230 and will update the standard to be consistent.
ETag - HTTP
WebHTTPHeadersETag
additionally, etags help prevent simultaneous updates of a resource from overwriting each other ("mid-air collisions").
Expect-CT - HTTP
builds of chrome are designed to stop enforcing the expect-ct policy 10 weeks after the installation's build date.
Feature-Policy: accelerometer - HTTP
candidate recommendation ...
Feature-Policy: battery - HTTP
candidate recommendation ...
Feature-Policy: payment - HTTP
specifications specification status comment payment request api candidate recommendation see section 16.
Feature-Policy: wake-lock - HTTP
wake lock api 1 candidate recommendation initial definition of wake-lock feature directive.
Feature-Policy - HTTP
the header has now been renamed to permissions-policy in the spec, and this article will eventually be updated to reflect that change.
If-Match - HTTP
WebHTTPHeadersIf-Match
for other methods, and in particular for put, if-match can be used to prevent the lost update problem.
If-Range - HTTP
WebHTTPHeadersIf-Range
http dates are always expressed in gmt, never in local time.
Keep-Alive - HTTP
examples a response containing a keep-alive header: http/1.1 200 ok connection: keep-alive content-encoding: gzip content-type: text/html; charset=utf-8 date: thu, 11 aug 2016 15:23:13 gmt keep-alive: timeout=5, max=1000 last-modified: mon, 25 jul 2016 04:32:39 gmt server: apache (body) specifications specification title http keep-alive header keep-alive header (ietf internet draft) rfc 7230, appendix a.1.2: keep-alive hypertext transfer protocol (http/1.1): message syntax and routing ...
Save-Data - HTTP
a value of on indicates explicit user opt-in into a reduced data usage mode on the client, and when communicated to origins allows them to deliver alternative content to reduce the data downloaded such as smaller image and video resources, different markup and styling, disabled polling and automatic updates, and so on.
Strict-Transport-Security - HTTP
whenever the strict-transport-security header is delivered to the browser, it will update the expiration time for that site, so sites can refresh this information and prevent the timeout from expiring.
Upgrade-Insecure-Requests - HTTP
candidate recommendation initial definition.
Firefox user agent string reference - HTTP
the third digit is incremented with regular version tags (about every 6 weeks) for security updates, and the fourth is owned by the oem.
Want-Digest - HTTP
when released, the "resource digests for http" draft therefore will obsolete rfc 3230 and will update the standard to be consistent.
HTTP Messages - HTTP
WebHTTPMessages
some requests send data to the server in order to update it: as often the case with post requests (containing html form data).
DELETE - HTTP
WebHTTPMethodsDELETE
http/1.1 200 ok date: wed, 21 oct 2015 07:28:00 gmt <html> <body> <h1>file deleted.</h1> </body> </html> specifications specification title rfc 7231, section 4.3.5: delete hypertext transfer protocol (http/1.1): semantics and content ...
HEAD - HTTP
WebHTTPMethodsHEAD
if the response to a head request shows that a cached url response is now outdated, the cached copy is invalidated even if no get request was made.
PATCH - HTTP
WebHTTPMethodsPATCH
patch is somewhat analogous to the "update" concept found in crud (in general, http is different than crud, and the two should not be confused).
Protocol upgrade mechanism - HTTP
the client adds this if it wishes to do so, and the server will include in the response a key of its own, which the client will validate before delivering the upgrade response to you.
HTTP Public Key Pinning (HPKP) - HTTP
firefox and chrome disable pin validation for pinned hosts whose validated certificate chain terminates at a user-defined trust anchor (rather than a built-in trust anchor).
204 No Content - HTTP
WebHTTPStatus204
if the page should be changed to the newly updated page, the 200 should be used instead.
301 Moved Permanently - HTTP
WebHTTPStatus301
a browser redirects to this page and search engines update their links to the resource (in 'seo-speak', it is said that the 'link-juice' is sent to the new url).
302 Found - HTTP
WebHTTPStatus302
a browser redirects to this page but search engines don't update their links to the resource (in 'seo-speak', it is said that the 'link-juice' is not sent to the new url).
304 Not Modified - HTTP
WebHTTPStatus304
the equivalent 200 ok response would have included the headers cache-control, content-location, date, etag, expires, and vary.
308 Permanent Redirect - HTTP
WebHTTPStatus308
a browser redirects to this page and search engines update their links to the resource (in 'seo-speak', it is said that the 'link-juice' is sent to the new url).
401 Unauthorized - HTTP
WebHTTPStatus401
status 401 unauthorized example response http/1.1 401 unauthorized date: wed, 21 oct 2015 07:28:00 gmt www-authenticate: basic realm="access to staging site" specifications specification title rfc 7235, section 3.1: 401 unauthorized http/1.1: authentication ...
402 Payment Required - HTTP
WebHTTPStatus402
status 402 payment required example response http/1.1 402 payment required date: wed, 21 oct 2015 07:28:00 gmt specifications specification title rfc 7231, section 6.5.2: 402 payment required http/1.1: semantics and content ...
403 Forbidden - HTTP
WebHTTPStatus403
status 403 forbidden example response http/1.1 403 forbidden date: wed, 21 oct 2015 07:28:00 gmt specifications specification title rfc 7231, section 6.5.3: 403 forbidden http/1.1: semantics and content ...
407 Proxy Authentication Required - HTTP
WebHTTPStatus407
status 407 proxy authentication required example response http/1.1 407 proxy authentication required date: wed, 21 oct 2015 07:28:00 gmt proxy-authenticate: basic realm="access to internal site" specifications specification title rfc 7235, section 3.2: 407 proxy authentication required http/1.1: authentication ...
About JavaScript - JavaScript
the first ever javascript was created by brendan eich at netscape, and has since been updated to conform to ecma-262 edition 5 and later versions.
Details of the object model - JavaScript
using this definition of the constructor, when you do not supply arguments, the constructor does not assign a value to the id and does not update the counter.
Introduction - JavaScript
javascript contains a standard library of objects, such as array, date, and math, and a core set of language elements such as operators, control structures, and statements.
Loops and iteration - JavaScript
if present, the update expression incrementexpression is executed.
Working with objects - JavaScript
examples are as follows: // four variables are created and assigned in a single go, // separated by commas var myobj = new object(), str = 'mystring', rand = math.random(), obj = new object(); myobj.type = 'dot syntax'; myobj['date created'] = 'string with space'; myobj[str] = 'string value'; myobj[rand] = 'random number'; myobj[obj] = 'object'; myobj[''] = 'even an empty string'; console.log(myobj); please note that all keys in the square bracket notation are converted to string unless they're symbols, since javascript object property names (keys) can only be strings...
JavaScript Guide - JavaScript
error objects loops and iteration for while do...while break/continue for..in for..of functions defining functions calling functions function scope closures arguments & parameters arrow functions expressions and operators assignment & comparisons arithmetic operators bitwise & logical operators conditional (ternary) operator numbers and dates number literals number object math object date object text formatting string literals string object template literals internationalization regular expressions indexed collections arrays typed arrays keyed collections map weakmap set weakset working with objects objects and properties creating objects defining methods getter and set...
JavaScript technologies overview - JavaScript
the internationalization api provides collation (string comparison), number formatting, and date-and-time formatting for javascript applications, letting the applications choose the language and tailor the functionality to their needs.
JavaScript language resources - JavaScript
the following ecmascript standards have been approved or are being worked on: name links release date description current editions ecma-262 10th edition pdf, html, working draft, repository 2019 ecmascript 2019 language specification ecma-262 9th edition pdf, html, working draft, repository 2018 ecmascript 2018 language specification ecma-402 5th edition working draft, repository 2018 ecmascript 2018 internationalization api specification obsolete/historical editions ecma-262 pdf ...
Memory Management - JavaScript
var d = new date(); // allocates a date object var e = document.createelement('div'); // allocates a dom element some methods allocate new values or objects: var s = 'azerty'; var s2 = s.substr(0, 3); // s2 is a new string // since strings are immutable values, // javascript may decide to not allocate memory, // but just store the [0, 3] range.
Deprecated and obsolete features - JavaScript
date methods getyear and setyear are affected by the year-2000-problem and have been subsumed by getfullyear and setfullyear.
SyntaxError: "x" is a reserved identifier - JavaScript
var colorenum = { red: 0, green: 1, blue: 2 }; var list = ["potatoes", "rice", "fries"]; update older browsers if you are using an older browser that does not yet implement let or class, for example, you should update to a more recent browser version that does support these new language features.
setter - JavaScript
when current is assigned a value, it updates log with that value: const language = { set current(name) { this.log.push(name); }, log: [] } language.current = 'en'; console.log(language.log); // ['en'] language.current = 'fa'; console.log(language.log); // ['en', 'fa'] note that current is not defined, and any attempts to access it will result in undefined.
Array.prototype.forEach() - JavaScript
[2, 5, , 9].foreach(logarrayelements) // logs: // a[0] = 2 // a[1] = 5 // a[3] = 9 using thisarg the following (contrived) example updates an object's properties from each entry in the array: function counter() { this.sum = 0 this.count = 0 } counter.prototype.add = function(array) { array.foreach((entry) => { this.sum += entry ++this.count }, this) // ^---- note } const obj = new counter() obj.add([2, 5, 9]) obj.count // 3 obj.sum // 16 since the thisarg parameter (this) is provided to foreach(), it is passed...
Error - JavaScript
', ...params) { // pass remaining arguments (including vendor specific ones) to parent constructor super(...params) // maintains proper stack trace for where our error was thrown (only available on v8) if (error.capturestacktrace) { error.capturestacktrace(this, customerror) } this.name = 'customerror' // custom debugging information this.foo = foo this.date = new date() } } try { throw new customerror('baz', 'bazmessage') } catch(e) { console.error(e.name) //customerror console.error(e.foo) //baz console.error(e.message) //bazmessage console.error(e.stack) //stacktrace } es5 custom error object all browsers include the customerror constructor in the stack trace when using a prototypal declaration.
Intl.getCanonicalLocales() - JavaScript
duplicates will be omitted and elements will be validated as structurally valid language tags.
JSON - JavaScript
examples example json { "browsers": { "firefox": { "name": "firefox", "pref_url": "about:config", "releases": { "1": { "release_date": "2004-11-09", "status": "retired", "engine": "gecko", "engine_version": "1.7" } } } } } specifications specification ecmascript (ecma-262)the definition of 'json' in that specification.
Number - JavaScript
using number to convert a date object the following example converts the date object to a numerical value using number as a function: let d = new date('december 17, 1995 03:24:00') console.log(number(d)) this logs 819199440000.
Object.prototype.__proto__ - JavaScript
for objects created using new fun, where fun is one of the built-in constructor functions provided by javascript (array, boolean, date, number, object, string, and so on — including new constructors added as javascript evolves), this value is always fun.prototype.
Object.prototype.toSource() - JavaScript
date.prototype.tosource() — date object.
Object.prototype.valueOf() - JavaScript
examples using valueof on custom types function mynumbertype(n) { this.number = n; } mynumbertype.prototype.valueof = function() { return this.number; }; var myobj = new mynumbertype(4); myobj + 3; // 7 using unary plus +"5" // 5 (string to number) +"" // 0 (string to number) +"1 + 2" // nan (doesn't evaluate) +new date() // same as (new date()).gettime() +"foo" // nan (string to number) +{} // nan +[] // 0 (tostring() returns an empty string list) +[1] // 1 +[1,2] // nan +new set([1]) // nan +bigint(1) // uncaught typeerror: cannot convert a bigint value to a number +undefined // nan +null // 0 +true // 1 +false // 0 specifications specification ecmascript (ecma-262)the definition of 'o...
Promise - JavaScript
"use strict"; // to experiment with error handling, "threshold" values cause errors randomly const threshold_a = 8; // can use zero 0 to guarantee error function tetheredgetnumber(resolve, reject) { try { settimeout( function() { const randomint = date.now(); const value = randomint % 10; try { if(value >= threshold_a) { throw new error(`too large: ${value}`); } } catch(msg) { reject(`error in callback ${msg}`); } resolve(value); return; }, 500); // to experiment with error at set-up, uncomment the following 'throw'.
Proxy.revocable() - JavaScript
revoke a function with no argument to invalidate (switch off) the proxy.
Proxy - JavaScript
validation with a proxy, you can easily validate the passed value for an object.
Comparing Reflect and Object methods - JavaScript
some of the static functions that exist on reflect also correspond to methods available on object, which predates es2015.
Reflect.construct() - JavaScript
} let obj3 = object.create(otherclass.prototype); oneclass.apply(obj3, args) // output: // oneclass // undefined examples using reflect.construct() let d = reflect.construct(date, [1776, 6, 4]) d instanceof date // true d.getfullyear() // 1776 specifications specification ecmascript (ecma-262)the definition of 'reflect.construct' in that specification.
RegExp.prototype.exec() - JavaScript
return value if the match succeeds, the exec() method returns an array (with extra properties index and input; see below) and updates the lastindex property of the regular expression object.
SharedArrayBuffer - JavaScript
var sab = new sharedarraybuffer(1024); worker.postmessage(sab); updating and synchronizing shared memory with atomic operations shared memory can be created and updated simultaneously in workers or the main thread.
String.prototype.localeCompare() - JavaScript
negative and positive integer results vary between browsers (as well as between browser versions) because the w3c specification only mandates negative and positive values.
WeakMap.prototype.set() - JavaScript
examples using the set method var wm = new weakmap(); var obj = {}; // add new elements to the weakmap wm.set(obj, 'foo').set(window, 'bar'); // chainable // update an element in the weakmap wm.set(obj, 'baz'); specifications specification ecmascript (ecma-262)the definition of 'weakmap.prototype.set' in that specification.
WebAssembly.Global() constructor - JavaScript
: ${got}<br>`; } asserteq("webassembly.global exists", typeof webassembly.global, "function"); const global = new webassembly.global({value:'i32', mutable:true}, 0); webassembly.instantiatestreaming(fetch('global.wasm'), { js: { global } }) .then(({instance}) => { asserteq("getting initial value from wasm", instance.exports.getglobal(), 0); global.value = 42; asserteq("getting js-updated value from wasm", instance.exports.getglobal(), 42); instance.exports.incglobal(); asserteq("getting wasm-updated value from js", global.value, 43); }); note: you can see the example running live on github; see also the source code.
WebAssembly.Global - JavaScript
: ${got}<br>`; } asserteq("webassembly.global exists", typeof webassembly.global, "function"); const global = new webassembly.global({value:'i32', mutable:true}, 0); webassembly.instantiatestreaming(fetch('global.wasm'), { js: { global } }) .then(({instance}) => { asserteq("getting initial value from wasm", instance.exports.getglobal(), 0); global.value = 42; asserteq("getting js-updated value from wasm", instance.exports.getglobal(), 42); instance.exports.incglobal(); asserteq("getting wasm-updated value from js", global.value, 43); }); note: you can see the example running live on github; see also the source code.
WebAssembly.Module.customSections() - JavaScript
most of these sections are fully specified and validated by the wasm spec, but modules can also contain custom sections that are ignored and skipped over during validation.
isNaN() - JavaScript
ted to the number 37 which is not nan isnan('37.37'); // false: "37.37" is converted to the number 37.37 which is not nan isnan("37,5"); // true isnan('123abc'); // true: parseint("123abc") is 123 but number("123abc") is nan isnan(''); // false: the empty string is converted to 0 which is not nan isnan(' '); // false: a string with spaces is converted to 0 which is not nan // dates isnan(new date()); // false isnan(new date().tostring()); // true // this is a false positive and the reason why isnan is not entirely reliable isnan('blabla'); // true: "blabla" is converted to a number.
Equality (==) - JavaScript
rence the same object for comparison to succeed: const string1 = "hello"; const string2 = string("hello"); const string3 = new string("hello"); const string4 = new string("hello"); console.log(string1 == string2); // true console.log(string1 == string3); // true console.log(string2 == string3); // true console.log(string3 == string4); // false console.log(string4 == string4); // true comparing dates and strings const d = new date('december 17, 1995 03:24:00'); const s = d.tostring(); // for example: "sun dec 17 1995 03:24:00 gmt-0800 (pacific standard time)" console.log(d == s); //true specifications specification ecmascript (ecma-262)the definition of 'equality operators' in that specification.
Logical OR assignment (||=) - JavaScript
examples setting default content if the "lyrics" element is empty, set the innerhtml to a default value: document.getelementbyid('lyrics').innerhtml ||= '<i>no lyrics.</i>' here the short-circuit is especially beneficial, since the element will not be updated unnecessarily and won't cause unwanted side-effects such as additional parsing or rendering work, or loss of focus, etc.
Object initializer - JavaScript
objects like date will be a string after json.parse().
Optional chaining (?.) - JavaScript
the optional chaining operator (?.) permits reading the value of a property located deep within a chain of connected objects without having to expressly validate that each reference in the chain is valid.
Spread syntax (...) - JavaScript
however, an array can be easily used with new thanks to spread syntax: const datefields = [1970, 0, 1]; // 1 jan 1970 const d = new date(...datefields); to use new with an array of parameters without spread syntax, you would have to do it indirectly through partial application: function applyandnew(constructor, args) { function partial () { return constructor.apply(this, args); }; if (typeof constructor.prototype === "object") { partial.prototype = obj...
typeof - JavaScript
eof symbol('foo') === 'symbol' typeof symbol.iterator === 'symbol' // undefined typeof undefined === 'undefined'; typeof declaredbutundefinedvariable === 'undefined'; typeof undeclaredvariable === 'undefined'; // objects typeof {a: 1} === 'object'; // use array.isarray or object.prototype.tostring.call // to differentiate regular objects from arrays typeof [1, 2, 4] === 'object'; typeof new date() === 'object'; typeof /regex/ === 'object'; // see regular expressions section for historical results // the following are confusing, dangerous, and wasteful.
continue - JavaScript
in a for loop, it jumps to the update expression.
export - JavaScript
bindings that are exported can still be modified locally; when imported, although they can only be read by the importing module the value updates whenever it is updated by the exporting module.
for - JavaScript
generally used to update or increment the counter variable.
import - JavaScript
bindings imported are called live bindings because they are updated by the module that exported the binding.
throw - JavaScript
this.tostring = function() { return string(this.value) }; } else { throw new zipcodeformatexception(zip); } } function zipcodeformatexception(value) { this.value = value; this.message = 'does not conform to the expected format for a zip code'; this.tostring = function() { return this.value + this.message; }; } /* * this could be in a script that validates address data * for us addresses.
JavaScript
standard objects get to know standard built-in objects array, boolean, date, error, function, json, math, number, object, regexp, string, map, set, weakmap, weakset, and others.
<mtable> - MathML
WebMathMLElementmtable
in gecko 17.0 (firefox 17.0 / thunderbird 17.0 / seamonkey 2.14) the parsing has been updated to treat whitespace correctly.
Handling media support issues in web content - Web media technologies
<img src="/images/stafff-photo-huge-progressive.jpg" alt="staff photo, taken in january of 1972"> when using a progressive image, the data is stored in such a way that the browser is able to render a low-quality representation of the image as soon as possible, then update the image as it loads—or after it's finished loading—to present it in full quality.
The "codecs" parameter in common media types - Web media technologies
note: the specification originally mandated that the audio object type number in the third component be only one decimal digit.
Using audio and video in HTML - Web media technologies
note: this guide is a planned update to integrate content from various scattered places on mdn into one cohesive document or document set.
Performance fundamentals - Web Performance
as your brain infers, motion is not jerky and discrete, but rather "updates" smoothly and continuously.
Populating the page: how browsers work - Web Performance
the browser updates the accessibility tree when the dom is updated.
Web Performance
beginner's tutorials the mdn web performance learning area contains modern, up-to-date tutorials covering performance essentials.
Add to Home screen - Progressive web apps (PWAs)
deferredprompt = e; // update ui to notify the user they can add to home screen addbtn.style.display = 'block'; addbtn.addeventlistener('click', (e) => { // hide our user interface that shows our a2hs button addbtn.style.display = 'none'; // show the prompt deferredprompt.prompt(); // wait for the user to respond to the prompt deferredprompt.userchoice.then((choiceresult) => { if (choicere...
The building blocks of responsive design - Progressive web apps (PWAs)
more functionality and a clean up of the styling of snapshot are planned for a future date.
SVG Event Attributes - SVG: Scalable Vector Graphics
WebSVGAttributeEvents
, onended, onerror, onfocus, oninput, oninvalid, onkeydown, onkeypress, onkeyup, onload, onloadeddata, onloadedmetadata, onloadstart, onmousedown, onmouseenter, onmouseleave, onmousemove, onmouseout, onmouseover, onmouseup, onmousewheel, onpause, onplay, onplaying, onprogress, onratechange, onreset, onresize, onscroll, onseeked, onseeking, onselect, onshow, onstalled, onsubmit, onsuspend, ontimeupdate, ontoggle, onvolumechange, onwaiting graphical event attributes onactivate, onfocusin, onfocusout ...
alignment-baseline - SVG: Scalable Vector Graphics
candidate recommendation refers to the definition in css inline layout and notes the changes to auto, before-edge, after-edge, text-before-edge, and text-after-edge scalable vector graphics (svg) 1.1 (second edition)the definition of 'alignment-baseline' in that specification.
baseline-shift - SVG: Scalable Vector Graphics
candidate recommendation refers to the definition in css inline layout and notes that vertical-align should be preferred.
begin - SVG: Scalable Vector Graphics
WebSVGAttributebegin
those are: focus, blur, focusin, focusout, activate, auxclick, click, dblclick, mousedown, mouseenter, mouseleave, mousemove, mouseout, mouseover, mouseup, wheel, beforeinput, input, keydown, keyup, compositionstart, compositionupdate, compositionend, load, unload, abort, error, select, resize, scroll, beginevent, endevent, and repeatevent.
clip-path - SVG: Scalable Vector Graphics
candidate recommendation extends its application to html elements.
clip - SVG: Scalable Vector Graphics
WebSVGAttributeclip
candidate recommendation deprecates clip property, suggests clip-path as replacement.
clipPathUnits - SVG: Scalable Vector Graphics
candidate recommendation scalable vector graphics (svg) 1.1 (second edition)the definition of 'clippathunits' in that specification.
color-interpolation - SVG: Scalable Vector Graphics
candidate recommendation no significant change scalable vector graphics (svg) 1.1 (second edition)the definition of 'color-interpolation' in that specification.
color - SVG: Scalable Vector Graphics
WebSVGAttributecolor
candidate recommendation removed the restriction to which elements it applies.
d - SVG: Scalable Vector Graphics
WebSVGAttributed
candidate recommendation definition for <path> scalable vector graphics (svg) 1.1 (second edition)the definition of 'd' in that specification.
data-* - SVG: Scalable Vector Graphics
WebSVGAttributedata-*
candidate recommendation custom data attributes are new in svg 2.
direction - SVG: Scalable Vector Graphics
candidate recommendation refers to the css writing modes specification of the direction property.
display - SVG: Scalable Vector Graphics
WebSVGAttributedisplay
candidate recommendation refers to the css 2 specification of the display property, but outlines the differences regarding svg.
dominant-baseline - SVG: Scalable Vector Graphics
candidate recommendation refers to the specification in working draft and explicitly mentions the removal of the values use-script, no-change, and reset-size.
dx - SVG: Scalable Vector Graphics
WebSVGAttributedx
candidate recommendation definition for <text> and <tspan> scalable vector graphics (svg) 1.1 (second edition)the definition of 'dx' in that specification.
dy - SVG: Scalable Vector Graphics
WebSVGAttributedy
candidate recommendation definition for <text> and <tspan> scalable vector graphics (svg) 1.1 (second edition)the definition of 'dy' in that specification.
end - SVG: Scalable Vector Graphics
WebSVGAttributeend
those are: focus, blur, focusin, focusout, activate, auxclick, click, dblclick, mousedown, mouseenter, mouseleave, mousemove, mouseout, mouseover, mouseup, wheel, beforeinput, input, keydown, keyup, compositionstart, compositionupdate, compositionend, load, unload, abort, error, select, resize, scroll, beginevent, endevent, and repeatevent .
fill-opacity - SVG: Scalable Vector Graphics
candidate recommendation definition for shapes and texts scalable vector graphics (svg) 1.1 (second edition)the definition of 'fill-opacity' in that specification.
fill-rule - SVG: Scalable Vector Graphics
candidate recommendation definition for shapes and text scalable vector graphics (svg) 1.1 (second edition)the definition of 'fill-rule' in that specification.
fill - SVG: Scalable Vector Graphics
WebSVGAttributefill
candidate recommendation definition for shapes and texts.
font-family - SVG: Scalable Vector Graphics
candidate recommendation no significant change scalable vector graphics (svg) 1.1 (second edition)the definition of 'font-family' in that specification.
font-size-adjust - SVG: Scalable Vector Graphics
candidate recommendation no change scalable vector graphics (svg) 1.1 (second edition)the definition of 'font-size-adjust' in that specification.
font-size - SVG: Scalable Vector Graphics
candidate recommendation no change scalable vector graphics (svg) 1.1 (second edition)the definition of 'font-size' in that specification.
font-stretch - SVG: Scalable Vector Graphics
candidate recommendation initial definition of font-stretch in css fonts scalable vector graphics (svg) 1.1 (second edition)the definition of 'font-stretch' in that specification.
font-style - SVG: Scalable Vector Graphics
candidate recommendation no change scalable vector graphics (svg) 1.1 (second edition)the definition of 'font-style' in that specification.
font-variant - SVG: Scalable Vector Graphics
candidate recommendation added many more keywords for different types of variations.
font-weight - SVG: Scalable Vector Graphics
candidate recommendation no change scalable vector graphics (svg) 1.1 (second edition)the definition of 'font-weight' in that specification.
fr - SVG: Scalable Vector Graphics
WebSVGAttributefr
candidate recommendation initial definition ...
fx - SVG: Scalable Vector Graphics
WebSVGAttributefx
candidate recommendation no change scalable vector graphics (svg) 1.1 (second edition)the definition of 'fx' in that specification.
fy - SVG: Scalable Vector Graphics
WebSVGAttributefy
candidate recommendation no change scalable vector graphics (svg) 1.1 (second edition)the definition of 'fy' in that specification.
id - SVG: Scalable Vector Graphics
WebSVGAttributeid
candidate recommendation defines the allowed values in more detail.
lang - SVG: Scalable Vector Graphics
WebSVGAttributelang
candidate recommendation made the lang attribute (without namespace) available on all elements and defined the interaction between both.
lengthAdjust - SVG: Scalable Vector Graphics
candidate recommendation no change scalable vector graphics (svg) 1.1 (second edition)the definition of 'lengthadjust' in that specification.
marker-end - SVG: Scalable Vector Graphics
candidate recommendation no significant change scalable vector graphics (svg) 1.1 (second edition)the definition of 'marker-end' in that specification.
marker-mid - SVG: Scalable Vector Graphics
candidate recommendation no significant change scalable vector graphics (svg) 1.1 (second edition)the definition of 'marker-mid' in that specification.
marker-start - SVG: Scalable Vector Graphics
candidate recommendation no significant change scalable vector graphics (svg) 1.1 (second edition)the definition of 'marker-start' in that specification.
markerHeight - SVG: Scalable Vector Graphics
candidate recommendation allowed percentage and number values.
markerUnits - SVG: Scalable Vector Graphics
candidate recommendation no significant change scalable vector graphics (svg) 1.1 (second edition)the definition of 'markerunits' in that specification.
markerWidth - SVG: Scalable Vector Graphics
candidate recommendation allowed percentage and number values.
mask - SVG: Scalable Vector Graphics
WebSVGAttributemask
candidate recommendation extends its usage to html elements.
maskContentUnits - SVG: Scalable Vector Graphics
candidate recommendation scalable vector graphics (svg) 1.1 (second edition)the definition of 'maskcontentunits' in that specification.
maskUnits - SVG: Scalable Vector Graphics
candidate recommendation scalable vector graphics (svg) 1.1 (second edition)the definition of 'maskunits' in that specification.
media - SVG: Scalable Vector Graphics
WebSVGAttributemedia
candidate recommendation changed the value definition from different media types as defined in css 2 to <media-query-list>.
method - SVG: Scalable Vector Graphics
WebSVGAttributemethod
candidate recommendation described the stretch value in more detail.
onclick - SVG: Scalable Vector Graphics
WebSVGAttributeonclick
candidate recommendation no change scalable vector graphics (svg) 1.1 (second edition)the definition of 'onclick' in that specification.
opacity - SVG: Scalable Vector Graphics
WebSVGAttributeopacity
candidate recommendation references the specification in css color 3 and notes that there are some related attributes.
orient - SVG: Scalable Vector Graphics
WebSVGAttributeorient
candidate recommendation added the auto-start-reverse value and simplified the descriptions of the values.
overflow - SVG: Scalable Vector Graphics
candidate recommendation simplifies the definition and outlines the values within the user agent stylesheet.
paint-order - SVG: Scalable Vector Graphics
candidate recommendation initial definition ...
path - SVG: Scalable Vector Graphics
WebSVGAttributepath
candidate recommendation initial definition for <textpath> svg animations level 2the definition of 'path for <animatemotion>' in that specification.
pathLength - SVG: Scalable Vector Graphics
candidate recommendation scalable vector graphics (svg) 1.1 (second edition)the definition of 'pathlength' in that specification.
patternContentUnits - SVG: Scalable Vector Graphics
candidate recommendation scalable vector graphics (svg) 1.1 (second edition)the definition of 'patterncontentunits' in that specification.
patternTransform - SVG: Scalable Vector Graphics
candidate recommendation scalable vector graphics (svg) 1.1 (second edition)the definition of 'patterntransform' in that specification.
patternUnits - SVG: Scalable Vector Graphics
candidate recommendation scalable vector graphics (svg) 1.1 (second edition)the definition of 'patternunits' in that specification.
pointer-events - SVG: Scalable Vector Graphics
candidate recommendation scalable vector graphics (svg) 1.1 (second edition)the definition of 'pointer-events' in that specification.
preserveAspectRatio - SVG: Scalable Vector Graphics
candidate recommendation scalable vector graphics (svg) 1.1 (second edition)the definition of 'preserveaspectratio' in that specification.
requiredExtensions - SVG: Scalable Vector Graphics
candidate recommendation iris replaced with urls scalable vector graphics (svg) 1.1 (second edition)the definition of 'requiredextensions' in that specification.
rx - SVG: Scalable Vector Graphics
WebSVGAttributerx
candidate recommendation definition as a geometry property scalable vector graphics (svg) 1.1 (second edition)the definition of 'rx' in that specification.
ry - SVG: Scalable Vector Graphics
WebSVGAttributery
candidate recommendation definition as a geometry property scalable vector graphics (svg) 1.1 (second edition)the definition of 'ry' in that specification.
shape-rendering - SVG: Scalable Vector Graphics
candidate recommendation no change scalable vector graphics (svg) 1.1 (second edition)the definition of 'shape-rendering' in that specification.
side - SVG: Scalable Vector Graphics
WebSVGAttributeside
candidate recommendation initial definition ...
spacing - SVG: Scalable Vector Graphics
WebSVGAttributespacing
candidate recommendation no change scalable vector graphics (svg) 1.1 (second edition)the definition of 'spacing' in that specification.
startOffset - SVG: Scalable Vector Graphics
candidate recommendation no change scalable vector graphics (svg) 1.1 (second edition)the definition of 'startoffset' in that specification.
stop-color - SVG: Scalable Vector Graphics
candidate recommendation added a note that in svg the transparent keyword is treated differently than in css.
stop-opacity - SVG: Scalable Vector Graphics
candidate recommendation refers to the definition in css colors 3, but allows percentage values.
stroke-dasharray - SVG: Scalable Vector Graphics
candidate recommendation definition for shapes and texts scalable vector graphics (svg) 1.1 (second edition)the definition of 'stroke-dasharray' in that specification.
stroke-dashoffset - SVG: Scalable Vector Graphics
candidate recommendation definition for shapes and texts scalable vector graphics (svg) 1.1 (second edition)the definition of 'stroke-dashoffset' in that specification.
stroke-linecap - SVG: Scalable Vector Graphics
candidate recommendation definition for shapes and texts scalable vector graphics (svg) 1.1 (second edition)the definition of 'stroke-linecap' in that specification.
stroke-linejoin - SVG: Scalable Vector Graphics
candidate recommendation definition for shapes and texts scalable vector graphics (svg) 1.1 (second edition)the definition of 'stroke-linejoin' in that specification.
stroke-miterlimit - SVG: Scalable Vector Graphics
candidate recommendation definition for shapes and texts scalable vector graphics (svg) 1.1 (second edition)the definition of 'stroke-miterlimit' in that specification.
stroke-opacity - SVG: Scalable Vector Graphics
candidate recommendation definition for shapes and texts scalable vector graphics (svg) 1.1 (second edition)the definition of 'stroke-opacity' in that specification.
stroke-width - SVG: Scalable Vector Graphics
candidate recommendation definition for shapes and texts scalable vector graphics (svg) 1.1 (second edition)the definition of 'stroke-width' in that specification.
stroke - SVG: Scalable Vector Graphics
WebSVGAttributestroke
candidate recommendation definition for shapes and texts.
style - SVG: Scalable Vector Graphics
WebSVGAttributestyle
candidate recommendation no change scalable vector graphics (svg) 1.1 (second edition)the definition of 'style' in that specification.
systemLanguage - SVG: Scalable Vector Graphics
candidate recommendation no change scalable vector graphics (svg) 1.1 (second edition)the definition of 'systemlanguage' in that specification.
tabindex - SVG: Scalable Vector Graphics
candidate recommendation initial definition ...
target - SVG: Scalable Vector Graphics
WebSVGAttributetarget
candidate recommendation removed the _replace value.
text-anchor - SVG: Scalable Vector Graphics
candidate recommendation no significant change scalable vector graphics (svg) 1.1 (second edition)the definition of 'text-anchor' in that specification.
text-rendering - SVG: Scalable Vector Graphics
candidate recommendation no change scalable vector graphics (svg) 1.1 (second edition)the definition of 'text-rendering' in that specification.
transform-origin - SVG: Scalable Vector Graphics
candidate recommendation ...
transform - SVG: Scalable Vector Graphics
candidate recommendation scalable vector graphics (svg) 1.1 (second edition)the definition of 'transform' in that specification.
vector-effect - SVG: Scalable Vector Graphics
candidate recommendation initial definition ...
viewBox - SVG: Scalable Vector Graphics
WebSVGAttributeviewBox
candidate recommendation scalable vector graphics (svg) 1.1 (second edition)the definition of 'viewbox' in that specification.
visibility - SVG: Scalable Vector Graphics
candidate recommendation mainly refers to css 2.1 scalable vector graphics (svg) 1.1 (second edition)the definition of 'visibility' in that specification.
writing-mode - SVG: Scalable Vector Graphics
candidate recommendation mainly refers to the definition in css writing modes 3 and defines a mapping between the deprecated svg 1.1 values and the new values.
xlink:title - SVG: Scalable Vector Graphics
candidate recommendation deprecated the attribute and made it only apply to <a>, <image>, <lineargradient>, <pattern>, <radialgradient>, <script>, <textpath>, and <use> scalable vector graphics (svg) 1.1 (second edition)the definition of 'seed' in that specification.
xml:lang - SVG: Scalable Vector Graphics
candidate recommendation made the lang attribute (without namespace) available on all elements and defined the interaction between both.
xml:space - SVG: Scalable Vector Graphics
candidate recommendation deprecates the attribute and suggests to use white-space instead.
SVG Attribute reference - SVG: Scalable Vector Graphics
WebSVGAttribute
, onended, onerror, onfocus, oninput, oninvalid, onkeydown, onkeypress, onkeyup, onload, onloadeddata, onloadedmetadata, onloadstart, onmousedown, onmouseenter, onmouseleave, onmousemove, onmouseout, onmouseover, onmouseup, onmousewheel, onpause, onplay, onplaying, onprogress, onratechange, onreset, onresize, onscroll, onseeked, onseeking, onselect, onshow, onstalled, onsubmit, onsuspend, ontimeupdate, ontoggle, onvolumechange, onwaiting graphical event attributes onactivate, onfocusin, onfocusout ...
<a> - SVG: Scalable Vector Graphics
WebSVGElementa
candidate recommendation replaced xlink:href attribute by href scalable vector graphics (svg) 1.1 (second edition)the definition of '<a>' in that specification.
<altGlyphItem> - SVG: Scalable Vector Graphics
the <altglyphitem> element provides a set of candidates for glyph substitution by the <altglyph> element.
<circle> - SVG: Scalable Vector Graphics
WebSVGElementcircle
candidate recommendation scalable vector graphics (svg) 1.1 (second edition)the definition of '<circle>' in that specification.
<clipPath> - SVG: Scalable Vector Graphics
WebSVGElementclipPath
candidate recommendation scalable vector graphics (svg) 1.1 (second edition)the definition of '<clippath>' in that specification.
<cursor> - SVG: Scalable Vector Graphics
WebSVGElementcursor
candidate recommendation replaced xlink:href by href attribute.
<defs> - SVG: Scalable Vector Graphics
WebSVGElementdefs
candidate recommendation no change scalable vector graphics (svg) 1.1 (second edition)the definition of '<defs>' in that specification.
<desc> - SVG: Scalable Vector Graphics
WebSVGElementdesc
candidate recommendation scalable vector graphics (svg) 1.1 (second edition)the definition of '<desc>' in that specification.
<ellipse> - SVG: Scalable Vector Graphics
WebSVGElementellipse
candidate recommendation added auto value for rx and ry scalable vector graphics (svg) 1.1 (second edition)the definition of '<ellipse>' in that specification.
<foreignObject> - SVG: Scalable Vector Graphics
candidate recommendation scalable vector graphics (svg) 1.1 (second edition)the definition of '<foreignobject>' in that specification.
<g> - SVG: Scalable Vector Graphics
WebSVGElementg
candidate recommendation scalable vector graphics (svg) 1.1 (second edition)the definition of '<g>' in that specification.
<image> - SVG: Scalable Vector Graphics
WebSVGElementimage
candidate recommendation allows omitting height and width scalable vector graphics (svg) 1.1 (second edition)the definition of '<image>' in that specification.
<line> - SVG: Scalable Vector Graphics
WebSVGElementline
candidate recommendation changed the x1, y1, x2 and y2 attributes to take <length>s, <percentage>s and <number>s scalable vector graphics (svg) 1.1 (second edition)the definition of '<line>' in that specification.
<linearGradient> - SVG: Scalable Vector Graphics
candidate recommendation scalable vector graphics (svg) 1.1 (second edition)the definition of '<lineargradient>' in that specification.
<marker> - SVG: Scalable Vector Graphics
WebSVGElementmarker
candidate recommendation scalable vector graphics (svg) 1.1 (second edition)the definition of '<marker>' in that specification.
<mask> - SVG: Scalable Vector Graphics
WebSVGElementmask
candidate recommendation scalable vector graphics (svg) 1.1 (second edition)the definition of '<mask>' in that specification.
<metadata> - SVG: Scalable Vector Graphics
WebSVGElementmetadata
candidate recommendation allowed global event attributes on the element.
<path> - SVG: Scalable Vector Graphics
WebSVGElementpath
candidate recommendation scalable vector graphics (svg) 1.1 (second edition)the definition of '<path>' in that specification.
<pattern> - SVG: Scalable Vector Graphics
WebSVGElementpattern
candidate recommendation scalable vector graphics (svg) 1.1 (second edition)the definition of '<pattern>' in that specification.
<polygon> - SVG: Scalable Vector Graphics
WebSVGElementpolygon
candidate recommendation no change scalable vector graphics (svg) 1.1 (second edition)the definition of '<polygon>' in that specification.
<polyline> - SVG: Scalable Vector Graphics
WebSVGElementpolyline
candidate recommendation scalable vector graphics (svg) 1.1 (second edition)the definition of '<polyline>' in that specification.
<radialGradient> - SVG: Scalable Vector Graphics
candidate recommendation added fr attribute scalable vector graphics (svg) 1.1 (second edition)the definition of '<radialgradient>' in that specification.
<rect> - SVG: Scalable Vector Graphics
WebSVGElementrect
candidate recommendation scalable vector graphics (svg) 1.1 (second edition)the definition of '<rect>' in that specification.
<script> - SVG: Scalable Vector Graphics
WebSVGElementscript
candidate recommendation scalable vector graphics (svg) 1.1 (second edition)the definition of '<script>' in that specification.
<stop> - SVG: Scalable Vector Graphics
WebSVGElementstop
candidate recommendation scalable vector graphics (svg) 1.1 (second edition)the definition of '<stop>' in that specification.
<style> - SVG: Scalable Vector Graphics
WebSVGElementstyle
candidate recommendation scalable vector graphics (svg) 1.1 (second edition)the definition of '<style>' in that specification.
<svg> - SVG: Scalable Vector Graphics
WebSVGElementsvg
candidate recommendation scalable vector graphics (svg) 1.1 (second edition)the definition of '<svg>' in that specification.
<switch> - SVG: Scalable Vector Graphics
WebSVGElementswitch
candidate recommendation clarified the evaluation of the systemlanguage attribute scalable vector graphics (svg) 1.1 (second edition)the definition of '<switch>' in that specification.
<symbol> - SVG: Scalable Vector Graphics
WebSVGElementsymbol
candidate recommendation allowed geometry properties to be specified on a symbol scalable vector graphics (svg) 1.1 (second edition)the definition of '<symbol>' in that specification.
<text> - SVG: Scalable Vector Graphics
WebSVGElementtext
candidate recommendation scalable vector graphics (svg) 1.1 (second edition)the definition of '<text>' in that specification.
<textPath> - SVG: Scalable Vector Graphics
WebSVGElementtextPath
candidate recommendation scalable vector graphics (svg) 1.1 (second edition)the definition of '<textpath>' in that specification.
<title> — the SVG accessible name element - SVG: Scalable Vector Graphics
WebSVGElementtitle
candidate recommendation scalable vector graphics (svg) 1.1 (second edition)the definition of '<title>' in that specification.
<tspan> - SVG: Scalable Vector Graphics
WebSVGElementtspan
candidate recommendation scalable vector graphics (svg) 1.1 (second edition)the definition of '<tspan>' in that specification.
<use> - SVG: Scalable Vector Graphics
WebSVGElementuse
candidate recommendation scalable vector graphics (svg) 1.1 (second edition)the definition of '<use>' in that specification.
<view> - SVG: Scalable Vector Graphics
WebSVGElementview
candidate recommendation scalable vector graphics (svg) 1.1 (second edition)the definition of '<view>' in that specification.
Namespaces crash course - SVG: Scalable Vector Graphics
it may save you from some annoying errors if you end up adding content from one of the unused namespaces at a later date.
SVG as an Image - SVG: Scalable Vector Graphics
candidate recommendation defines the usage of svg within the background-image property.
Secure contexts - Web security
}); } specifications specification status comment secure contexts candidate recommendation editor’s draft ...
Subdomain takeovers - Web security
create an inventory of all of your organization’s domains and their hosting providers, and update it as things change, to ensure that nothing is left dangling.
Transport Layer Security - Web security
it was updated to ssl 3.0 not long after, and as its usage expanded, it became clear that a common, standard encryption technology needed to be specified to ensure interoperability among all web browsers and servers.
Types of attacks - Web security
cross-site scripting attacks usually occur when 1) data enters a web app through an untrusted source (most often a web request) or 2) dynamic content is sent to a web user without being validated for malicious content.
Tutorials
advanced level javascript guide a comprehensive, regularly updated guide to javascript for all levels of learning from beginner to advanced.
HTML Imports - Web Components
see this status update for more information.
Using templates and slots - Web Components
so, if we want to add a slot into our trivial example, we could update our template's paragraph element like this: <p><slot name="my-text">my default text</slot></p> if the slot's content isn't defined when the element is included in the markup, or if the browser doesn't support slots, <my-paragraph> just contains the fallback content "my default text".
<xsl:stylesheet> - XSLT: Extensible Stylesheet Language Transformations
input-type-annotations specifies whether type annotations are stripped from the element so the same results are produced whether the source documents have been validated against a schema or not.
The Netscape XSLT/XPath Reference - XSLT: Extensible Stylesheet Language Transformations
development of the xslt processor is ongoing, and this document will be updated as functionality is expanded.
Using the Mozilla JavaScript interface to XSL Transformations - XSLT: Extensible Stylesheet Language Transformations
cessor = new xsltprocessor(); do this: var processor = components.classes["@mozilla.org/document-transformer;1?type=xslt"] .createinstance(components.interfaces.nsixsltprocessor); see also the xslt javascript interface in gecko document.load() regarding the loading of xml documents (as used above) original document information author(s): mike hearn last updated date: december 21, 2005 copyright information: copyright (c) mike hearn ...
Compiling an Existing C Module to WebAssembly - WebAssembly
depending on the size of your image, you might run into an error where wasm can't grow the memory enough to accommodate both the input and the output image: luckily, the solution to this problem is in the error message.
WebAssembly
61firefox android full support 58opera android full support 45safari ios no support nosamsung internet android full support 8.0nodejs no support novalidatechrome full support 57edge full support 16firefox full support 52notes full support 52notes notes disabled in the firefox 52 extended support release (esr).ie no support noop...